Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR608 IGR600 IGR601 IGR602 IGR604 IGR607 IGR606 IGR603 IGR605 CT737 CT728 serS, - CT729 CT733 zntA,cadA, - CT727 CT736 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 CT737 CT728 serS, - CT729 CT733 zntA,cadA, - CT727 CT736 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 CT737 serS, - CT729 CT733 zntA,cadA, - CT727 CT728 CT736 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 ribE, - CT732 ribE, - CT732
* Calculated from Protein Sequence

Gene ID: CT732

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribE  

Definition:
riboflavin synthase beta chain

Gene Start:
844617

Gene Stop:
845087

Gene Length:
471

Molecular Weight*:
16396

pI*:
6.73

Net Charge*:
-0.53

EC:
2.5.1.9  

Functional Class:
cofactor biosynthesis; riboflavin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Riboflavin metabolism

Comment:
This protein is involved in the final step of riboflavin biosynthesis.
In HAEIN, the oligomer is said to consist of three alpha and 60 beta chains.
See CT405 for the alpha chain sequence. See also CT730,
CT731.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to riboflavin synthase beta subunit sequences, e.g. residues 1-151 are 45% similar to the A.aeolicus enzyme (AE000675).
No similarities to T.pallidum or M.genitalium.

CT732 is orthologous to CPn0873: residues 1-154 are 63% similar to CPn0873.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0054
COG name: Riboflavin synthase beta-chain
Functional Class:  H
The phylogenetic pattern of COG0054 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 14 to 118 are 36% similar to synthase chain beta domain as seen in RISB_ACTPL. Residues 121 to 154 are 52% similar to 6,7-dimethyl-8-ribityllumazine synthase domain as seen in RISB_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 10 to 154 (E-value = 3e-40) place CT732 in the DMRL_synthase family which is described as 6,7-dimethyl-8-ribityllumazine synthase (PF00885)

PDB Hit:
gi|1942903|pdb|1RVV|A Chain A, SynthaseRIBOFLAVIN SYNTHASE COMPLEX OF BACILLUS SUBTILIS Riboflavin Synthase, Transferase, Flavoprotein Mol_id: 1; Molecule: Riboflavin Synthase; Chain: A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X,

Gene Protein Sequence:
MKPLKGCPVAKDVRVAIVGSCFNSPIADRLVAGAQETFFDFGGDPSSLTI
VRVPGAFEIPCAIKKLLSTSGQFHAVVACGVLIQGETSHYEHIADSVAAG
VSRLSLDFCLPITFSVITAPNMEAAWERAGIKGPNLGASGMKTALEMASL
FSLIGKE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCGTTGAAAGGATGTCCTGTCGCTAAGGATGTGCGTGTAGCTAT
TGTTGGGTCATGTTTCAATTCTCCTATCGCTGATAGGCTTGTTGCTGGGG
CGCAAGAAACCTTTTTCGATTTCGGAGGAGATCCTTCTTCTTTAACAATT
GTCCGAGTCCCTGGGGCGTTTGAGATTCCTTGTGCGATTAAGAAATTACT
TTCCACCTCAGGACAGTTTCATGCTGTGGTTGCTTGCGGAGTGTTGATTC
AGGGCGAGACATCGCATTATGAACATATAGCAGATAGTGTGGCTGCAGGT
GTTAGTCGCCTATCCTTAGACTTCTGTCTTCCTATTACATTTTCCGTGAT
TACTGCTCCTAATATGGAAGCGGCTTGGGAGCGTGCGGGTATCAAAGGGC
CCAATTTAGGCGCTTCAGGCATGAAAACAGCTTTAGAAATGGCATCATTA
TTCTCTCTGATAGGGAAGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy