Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR600 IGR601 IGR602 IGR604 IGR607 IGR606 IGR603 IGR605 CT728 serS, - CT729 CT733 zntA,cadA, - CT727 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 CT728 serS, - CT729 CT733 zntA,cadA, - CT727 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 CT728 serS, - CT729 CT733 zntA,cadA, - CT727 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 ribE, - CT732 ribE, - CT732
* Calculated from Protein Sequence

Gene ID: CT731

DNA Molecule Name:
1  

Genbank ID:
3329189

Gene Name:
B  ribA  

Definition:
GTP cyclohydrolase II /3,4-dihydroxy-2-butanone-4-phoshate synthase

Gene Start:
843374

Gene Stop:
844645

Gene Length:
1272

Molecular Weight*:
46664

pI*:
5.08

Net Charge*:
-15.26

EC:
3.5.4.25  

Functional Class:
cofactor biosynthesis; riboflavin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Riboflavin metabolism

Comment:
Forms 2,5-DIAMINO-6-HYDROXY-4-(5-PHOSPHORIBOSYLAMINO)PYRIMIDINE as part of riboflavin biosynthesis. See CT730 and CT732.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone-4-phoshate synthaseproteins, e.g., 48% similarity to ) GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone-4-phoshate synthase in Arabidopsis thaliana, 50% similarity to GCH2_MYCTU.
No similarities to T.pallidum or M.genitalium.

CT731 is orthologous to CPn0872: residues 6-406 are 66% similar to CPn0872.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0807
COG name: GTP cyclohydrolase II
Functional Class:  H
The phylogenetic pattern of COG0807 is a---yqvcebRhUJ----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 309-331 are significantly matched to PR00487A, concerned with filaggrin signature proteins, e.g. HUMPROFILA and HUMPROFILX.


ProDom Summary:  Protein Domain Search
Residues 18 to 174 are 47% similar to a GTP II cyclohydrolase 4-phosphate domain as seen in RIBB_PHOPO. Residues 211-333, 335-375 are 60%, 48% similar to a GTP cyclohydrolase domain as seen in GCH2_ARATH.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 11 to 206 (E-value = 8.3e-95) place CT731 in the DHBP_synthase family which is described as 3,4-dihydroxy-2-butanone 4-phosphate synthase (PF00926)
Residues 209 to 380 (E-value = 1.4e-97) place CT731 in the GTP_cyclohydro2 family which is described as GTP cyclohydrolase II (PF00925)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
61  
159

PDB Hit:
none

Gene Protein Sequence:
MFTCEAGIASVQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKM
SFLLSHTTGIVCASLSREQAKSLDLPAMVQDNQCAFKTAFTVSVDASSGV
TTGVSASDRTRTVQLLADPAATAESFVRPGHVFPLISQPGGAVQRPGHTE
AAMDLMRLAGMQPCGIFAELVNPDHSMMRQQQVLAFAEQHDLTVITVDDL
ITYRYTYDSLVTKISSARLPTKYGDFSIHVYESIIDGTQHFALVKGDIHE
QEAVPVRVHSECLTGDILGSCRCDCGAQLDMAMRYIAEEGLGVIVYLRGQ
EGRGIGFGHKIRAYALQDLGYDTVDANLQLGFPIDAREYGMAAQVLKDLQ
LTSVRLITHNPRKFFELQRLGIHVLDRIILPVSISTENEGYLRTKKERMG
HWLDLPVLDDVEEEYETVERMSCR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTACATGTGAAGCTGGGATAGCGTCGGTACAGCAAGCGATAAAAGA
TGTCGCTGAAGGGAAATTTGTCATAGTTATTGATGCAGCATCTCGAGAAA
ACGAAGGAGACTTAATCCTTGCCGGAGAAAAAGTCTCTACAGAGAAAATG
AGTTTTCTTTTATCCCACACCACAGGTATTGTCTGTGCCTCGCTCTCTCG
AGAGCAGGCAAAATCTTTGGACTTGCCAGCCATGGTTCAAGACAACCAAT
GTGCGTTTAAAACCGCTTTTACCGTTTCCGTAGATGCTTCTTCAGGAGTG
ACTACAGGTGTGTCTGCGAGTGATCGCACCAGAACTGTGCAATTGTTAGC
TGATCCGGCAGCGACAGCCGAGTCCTTTGTTCGACCAGGGCATGTTTTCC
CTTTGATCAGTCAACCTGGCGGTGCAGTTCAACGTCCTGGGCACACCGAA
GCTGCTATGGATCTCATGCGGCTTGCAGGTATGCAGCCGTGTGGTATTTT
TGCTGAGTTAGTCAATCCAGACCACTCTATGATGCGACAGCAGCAGGTAC
TCGCTTTTGCTGAGCAACATGATTTAACTGTTATTACTGTGGATGATTTG
ATTACTTATCGATATACCTATGATTCCCTCGTTACTAAAATCTCATCGGC
GCGATTACCTACGAAATACGGAGATTTTTCAATCCATGTTTATGAGTCAA
TCATCGATGGGACCCAGCATTTTGCATTAGTTAAAGGAGATATCCATGAA
CAAGAAGCTGTTCCAGTGCGTGTGCATTCGGAATGTCTGACTGGGGATAT
TCTGGGGTCTTGTCGCTGTGATTGTGGAGCACAGCTAGATATGGCGATGC
GGTACATAGCAGAAGAGGGGCTGGGAGTTATTGTGTATCTTCGAGGCCAA
GAGGGGCGCGGTATCGGTTTTGGACATAAGATCCGCGCATATGCGCTTCA
AGATTTAGGTTATGATACTGTTGATGCGAATCTTCAATTAGGGTTCCCTA
TAGATGCTCGTGAATATGGCATGGCTGCTCAGGTTCTTAAAGACCTTCAG
TTGACAAGCGTGAGACTGATCACCCATAATCCAAGAAAATTTTTTGAGTT
ACAGCGGTTAGGAATACACGTTCTTGACCGAATTATTTTGCCCGTCAGTA
TTTCTACCGAAAATGAGGGGTATTTGCGAACAAAAAAGGAACGCATGGGG
CATTGGTTAGATCTGCCCGTTCTGGATGATGTGGAGGAAGAGTATGAAAC
CGTTGAAAGGATGTCCTGTCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy