Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR600 IGR601 IGR602 IGR604 IGR599 IGR606 IGR603 IGR605 CT728 rodA, - CT726 serS, - CT729 CT733 zntA,cadA, - CT727 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 CT728 rodA, - CT726 serS, - CT729 CT733 zntA,cadA, - CT727 CT734 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 CT728 rodA, - CT726 serS, - CT729 CT733 zntA,cadA, - CT727 ribD, - CT730 B,ribA, - CT731 dagA, - CT735 ribE, - CT732 ribE, - CT732 CT734
* Calculated from Protein Sequence

Gene ID: CT730

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribD  

Definition:
riboflavin-specific deaminase

Gene Start:
842137

Gene Stop:
843261

Gene Length:
1125

Molecular Weight*:
41076

pI*:
7.46

Net Charge*:
2.09

EC:
3.5.4.-  

Functional Class:
cofactor biosynthesis; riboflavin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Riboflavin metabolism

Comment:
Catalyzes formation of 5-AMINO-6-(RIBOSYLAMINO)-2,4(1H,3H)-PYRIMIDINEDIONE 5'-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to riboflavin specific deaminase proteins, e.g., 33% similarity to RIBG_BACSU, 35% similarity to RIBG_BACAM.
No similarities to T.pallidum or M.genitalium.

CT730 is orthologous to CPn0871: residues 1-368 are 53% similar to CPn0871.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1985
COG name: Pyrimidine reductase, riboflavin biosynthesis
Functional Class:  H
The phylogenetic pattern of COG1985 is amt-yQvcebRhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 55-61, 70-87, 79-96 are significantly matched to BL00903A, B, concerned with Cytidine and deoxycytidylate deaminases, e.g. RIBD_ACTPL.

ProDom Summary:  Protein Domain Search
Residues 11 to 145 are 48% similar to a deaminase riboflavin-specific domain as seen in FCA1_CANAL and FCY1_YEAST. Residues 223-336, 150-212 are 37%, 53% similar to a deaminase riboflavin-specific domain respectively, as seen in RIBD_METJA.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 105 (E-value = 5.4e-36) place CT730 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)
Residues 152 to 363 (E-value = 3.9e-95) place CT730 in the RibD_C family which is described as RibD C-terminal domain (PF01872)

PDB Hit:
none

Gene Protein Sequence:
MEVLSEQQLFFMRKAVALGEKGRIFAPPNPWVGCVIVKNGCVIGEGWHQG
IGSPHAEVCAVQDQKCSLEGAEVFVTLEPCCHFGRTPPCVDLLIKSKVAA
VYVGLLDPDPRVCKKGVARLQAAGIPVYVGVGSQEAKTSLQPYLYQRERG
LPWVVMKTAASLDGQTADRGGSSQWISGELARADVGKLRAESQAIIVGAR
TVCLDNPRLSARFPHGDLYERQPLRVVVDSRGTVPLESRVFDLSSGSTLF
ATTQQCPKEYIQKLKDLGVEVWESSSHQVDLKGLLRYLAERGCLQVLVEG
GAQLHSAFWQQKLVNAGVIYWGPKFLGDQGQPMLRDLQLSLVTAEHVRIT
ETSLVRDSVKTCFECLEQESVDKKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGTTTTGTCTGAGCAACAACTGTTTTTTATGCGCAAAGCCGTTGC
CTTAGGAGAAAAGGGAAGGATTTTTGCTCCACCCAATCCTTGGGTGGGAT
GTGTGATTGTAAAGAATGGTTGTGTGATAGGTGAGGGTTGGCATCAAGGA
ATCGGTTCTCCTCATGCAGAGGTGTGCGCAGTTCAAGATCAAAAATGTTC
TTTAGAAGGAGCTGAGGTGTTTGTCACCCTAGAACCATGTTGTCATTTCG
GTAGGACGCCACCTTGCGTGGATCTTTTAATTAAAAGTAAGGTTGCTGCA
GTTTATGTTGGCTTACTAGATCCGGATCCGCGTGTTTGTAAAAAAGGCGT
AGCCCGTTTGCAAGCAGCAGGGATTCCTGTTTATGTTGGGGTAGGGAGTC
AGGAGGCCAAAACTTCTTTGCAACCTTATCTGTATCAACGAGAGCGGGGA
TTGCCATGGGTAGTGATGAAAACAGCAGCTTCGCTAGATGGTCAGACCGC
AGATCGAGGAGGATCATCGCAATGGATTTCAGGAGAATTAGCTCGGGCAG
ATGTAGGGAAACTTCGTGCAGAGTCTCAGGCTATAATTGTTGGGGCTCGT
ACCGTTTGTTTAGATAATCCGCGTTTGTCGGCACGGTTCCCTCATGGAGA
TTTATATGAAAGACAGCCATTAAGAGTAGTGGTAGATAGTCGCGGAACAG
TCCCATTAGAATCTAGGGTATTCGATCTCAGCTCAGGGAGTACGCTATTT
GCTACGACTCAACAGTGCCCTAAAGAATATATTCAAAAATTGAAAGATTT
AGGAGTAGAAGTATGGGAATCTTCTTCTCATCAGGTCGATCTCAAAGGGC
TTTTGCGCTATCTGGCAGAGAGAGGGTGTTTACAGGTGCTTGTTGAGGGT
GGCGCGCAGCTACACTCCGCTTTCTGGCAACAGAAGCTCGTCAATGCAGG
GGTCATTTATTGGGGGCCGAAGTTTTTGGGTGATCAAGGGCAACCTATGT
TGCGAGATCTTCAGCTAAGTCTGGTTACAGCAGAACATGTAAGGATTACA
GAAACTTCTTTAGTTAGGGATTCTGTAAAGACATGTTTTGAATGTTTGGA
GCAAGAGAGTGTAGATAAGAAGGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy