Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR598 IGR600 IGR601 IGR602 IGR604 IGR599 IGR603 CT728 rodA, - CT726 serS, - CT729 CT733 zntA,cadA, - CT727 birA, - CT725 ribD, - CT730 B,ribA, - CT731 CT728 rodA, - CT726 serS, - CT729 CT733 zntA,cadA, - CT727 birA, - CT725 ribD, - CT730 B,ribA, - CT731 CT728 rodA, - CT726 serS, - CT729 CT733 zntA,cadA, - CT727 birA, - CT725 ribD, - CT730 B,ribA, - CT731 ribE, - CT732 ribE, - CT732
* Calculated from Protein Sequence

Gene ID: CT729

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
serS  

Definition:
seryl-tRNA synthetase

Gene Start:
842095

Gene Stop:
840812

Gene Length:
1284

Molecular Weight*:
48304

pI*:
5.86

Net Charge*:
-7.55

EC:
6.1.1.11  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Seryl-tRNA synthetase is a cytoplasmically located homodimer which belongs to class-II aminoacyl-tRNA synthetases.

Reaction: ATP + l-serine + tRNA(ser) = AMP + pyrophosphate + l-seryl-tRNA(ser).


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to seryl-tRNA synthetase proteins, e.g., 38% similarity to SYS_BACSU, 37% similarity to SYS_ECOLI.
CT729 is similar to TP0647, a predicted seryl-tRNA synthetase in T.pallidum. It
is also similar to MG005 in M.genitalium.

CT729 is orthologously related to CPn0870: residues 1-425 of CT729 are 74%
similar to residues 1-425 of CPn0870, a predicted seryl-tRNA synthetase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0172
COG name: Seryl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0172 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 139-411 are 43% similar to a serine-tRNA synthetase domain as seen in SYS_BACSU. Residues 1 to 75 are 38% similar to a serine-tRNA synthetase domain as seen in SYS_STAAU. Residues 1 to 82 are 27% similar to a seryl-tRNA synthetase domain as seen in SYS_HALMA.

Paralogs:  Local Blast Search
This protein is paralogously related to two other CT proteins: CT581,
threonyl-tRNA synthetase and CT393, prolyl-tRNA synthetase.
Residues 116-374 are 23% similar to CT581 and residues 195-317 are
25% similar to CT393.

Pfam Summary:  Pfam Search
Residues 1 to 107 (E-value = 1.6e-32) place CT729 in the Seryl_tRNA_N family which is described as Seryl-tRNA synthetase N-terminal domain (PF02403)
Residues 161 to 317 (E-value = 5.8e-54) place CT729 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
30  
102

PDB Hit:
gi|494615|pdb|1SRY|A Chain A, Seryl-Trna Synthetase (E.C.6.1.1.11)

Gene Protein Sequence:
MLDIRLIRKEPKECESRLQKKDPAISLERLLDLDKTVRQLKADSEALLAK
RKVLSGQIHKAKVANENADALIQEVNTIADQLVAFETTLQEQEALLEDLM
ARLPNYPDEDVPVSPDKTGNQVIKGHGEVPTFPFPPKHHMQLNEALQILD
FKLPAKTTGSGWPAYCNEGVLLEWALLTYLLNKQQAHGFQLWLPPLLVKR
DILFGSGQIPKFDGQYYRVEDGDQSLFLIPTAEVVLNGFHSQEILNEQDL
PLCYAAFTPCFRREAGAGGAHERGLVRVHQFHKVEMFAFTTPEQEEVVYQ
KMLHVVEEILSELQLPYQLSLLSTGDMSFTAKKTIDAEVWLPGQKAFYEV
SSISKCGDFQARRSETRYRDAQGKLHFVNTLNGSGLATPRLLVAILENYQ
QADGSVVIPSVLRPYMNNQEILLPKTVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGATATACGATTAATACGCAAGGAACCAAAAGAGTGCGAAAGCCG
TCTTCAAAAAAAAGATCCCGCTATTTCTTTAGAACGCCTCCTAGACTTGG
ATAAAACTGTGCGTCAGTTAAAGGCGGATTCAGAAGCTCTGCTTGCAAAG
CGTAAGGTATTATCTGGTCAGATTCATAAAGCTAAAGTTGCTAACGAAAA
TGCTGACGCCTTGATTCAAGAAGTGAATACTATTGCAGATCAACTCGTTG
CATTTGAAACAACTTTGCAAGAACAGGAAGCACTTCTAGAAGATCTCATG
GCGAGACTGCCTAATTATCCAGATGAAGATGTTCCAGTTTCTCCTGATAA
AACAGGAAACCAAGTGATTAAAGGCCACGGTGAGGTACCTACTTTTCCTT
TCCCTCCCAAACACCATATGCAACTTAATGAAGCGTTGCAAATTTTAGAC
TTTAAACTCCCTGCCAAAACTACAGGGTCTGGCTGGCCGGCTTATTGTAA
TGAAGGAGTTCTTCTAGAATGGGCTCTGCTTACTTATCTTCTGAATAAAC
AGCAAGCACATGGCTTTCAATTGTGGCTCCCTCCCTTACTTGTTAAACGA
GATATTCTCTTCGGTTCAGGACAAATTCCTAAGTTCGATGGACAGTATTA
CCGTGTTGAGGATGGAGATCAGTCTCTTTTCCTTATCCCGACAGCAGAAG
TCGTCCTCAATGGATTCCATTCTCAAGAAATTCTAAATGAGCAAGATCTC
CCTCTCTGTTATGCTGCATTTACTCCCTGCTTCCGCAGAGAGGCTGGCGC
TGGAGGAGCTCACGAACGAGGACTTGTGCGAGTCCATCAGTTCCACAAAG
TAGAAATGTTTGCTTTCACTACTCCGGAACAAGAAGAAGTTGTCTATCAA
AAAATGCTTCATGTTGTGGAAGAAATTCTGTCTGAACTGCAACTCCCCTA
TCAGCTTTCCTTACTTTCCACAGGAGACATGTCATTCACTGCTAAGAAAA
CGATCGATGCAGAAGTGTGGCTCCCAGGACAAAAAGCGTTCTATGAAGTC
TCCTCTATTTCTAAATGCGGAGATTTTCAAGCTCGACGATCCGAAACACG
CTATCGAGATGCTCAAGGTAAATTGCACTTCGTTAACACTCTAAACGGCT
CTGGATTGGCAACGCCAAGATTGTTGGTCGCTATTTTAGAAAATTATCAG
CAAGCGGATGGCTCTGTCGTCATTCCTTCTGTTCTTCGCCCCTATATGAA
TAACCAAGAGATTCTCCTACCCAAAACGGTAAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy