Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR598 IGR600 IGR597 IGR601 IGR602 IGR599 IGR603 IGR596 IGR595 pgmA,gpmA, - CT722 CT728 rodA, - CT726 serS, - CT729 zntA,cadA, - CT727 CT724 birA, - CT725 yjbC, - CT723 ribD, - CT730 B,ribA, - CT731 pgmA,gpmA, - CT722 CT728 rodA, - CT726 serS, - CT729 zntA,cadA, - CT727 CT724 birA, - CT725 yjbC, - CT723 ribD, - CT730 B,ribA, - CT731 pgmA,gpmA, - CT722 CT728 rodA, - CT726 serS, - CT729 zntA,cadA, - CT727 CT724 birA, - CT725 yjbC, - CT723 ribD, - CT730 B,ribA, - CT731
* Calculated from Protein Sequence

Gene ID: CT727

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
zntA  cadA  

Definition:
cation-transporting ATPase

Gene Start:
840002

Gene Stop:
838026

Gene Length:
1977

Molecular Weight*:
70561

pI*:
7.16

Net Charge*:
0.87

EC:
3.6.1.-  

Functional Class:
transport and binding; cations  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis

Comment:
An antiporter protein that is responsible for cation (perhaps specifically cadmium) efflux.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to probable cadmium-transporting ATPase proteins, e.g., 28% similarity to CADA_STAAU, 28% similarity to CADA_BACFI.
CT727 is similar to TP1036, a predicted cation-transporting ATPase in T.pallidum.
It is also similar to MG071 in M.genitalium.
CT727 is orthologously related to CPn0868: residues 1-658 are 71% similar to CPn0868.

COGS Summary:  COGS Search
BeTs to 12 clades of COG2217
COG name: Cation transport ATPases
Functional Class:  P
The phylogenetic pattern of COG2217 is AmT-YQvCEBRhUJ---lin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 175-189, 309-348, 140-179, 350-368, 484-524, 532-572, 93-133 are significantly matched to BL00154A,B,C,D,E, concerned with E1-E2 ATPase phosphorylation site proteins, e.g. ATKB_ECOLI and ATKB_ENTFA. Residues 493-517, 550-574 are significantly matched to BL01228B, D, concerned with Hypothetical cof family proteins, e.g. COF_ECOLI, Y003_HAEIN and Y263_MYCPN.

ProDom Summary:  Protein Domain Search
Residues 231-353 are 37% similar to an ATPase pump calcium-transporting domain as seen in CADA_STAAU.
Residues 135-206 and 549-605 support this finding as evidenced by similarities to
CADD_STAAU, FIXI_RHIME.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 121 to 346 (E-value = 4.9e-52) place CT727 in the E1-E2_ATPase family which is described as E1-E2 ATPase (PF00122)
Residues 350 to 575 (E-value = 1.4e-33) place CT727 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
44
transmembrane  
49  
83
transmembrane  
102  
133
transmembrane  
273  
290
transmembrane  
299  
331
transmembrane  
612  
646

PDB Hit:
None.

Gene Protein Sequence:
MSPQLFSSPFSRELLSYFFESGMAEENSPLLSQKNRRLSQNLTLKSAYIS
LALYLGSLLSHWIGYQALSSLLLILTFFLAGTPALIKSFEDILDRTVNID
ILMTSAAFGSIFIGGALEGALLLVLFAISESLGAMVSGKAKSTLASLKHL
APTVAWVVQQDGSLQKVLVQNVKVGEIIRVKSGEVVPLDGKIIQGASSIN
LMHLTGEKIPKSCGIGDTIPAGAHNLEGSFDLQVLRIGAESTIAHIINLV
VQAQSSKPKLQQRLDRYSSTYALTIFAISACIAIGGSLFTTLPFLGPDSA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVVLDRLVSC
NSVVMDKTGTLTTGDLTCSGCEDFGPESPLFYSCVLAMEQSSSHPIAQAI
VNYLTEKQVRSLPATQCTTIPGEGVSGEFNGEQAFVGRVSTALRYVPEEY
REQLRERAQQAQERGDTCSIACLGKRVSLFYFRDVPRHDAADIVSYLKKN
GYPVCMLTGDHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQIM
MIGDGINDAPALAQATVGIAMGEAGSATAIEAADVVLLNQGLSSLPWLID
KAKKTRRIVSQNLALALAIILFISGPASMGVIPLWLAVILHEGSTVIVGL
NALRLLKNT

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCCGCAACTTTTTTCCTCTCCATTTTCTCGAGAATTACTCAGCTA
TTTTTTTGAATCAGGGATGGCGGAAGAGAATAGCCCTCTGCTCTCTCAAA
AAAACCGTCGTTTAAGCCAAAATTTAACCTTAAAATCTGCCTATATCTCC
TTGGCTTTATACTTAGGATCGCTTCTTTCTCATTGGATAGGATATCAGGC
TCTCTCCTCTTTACTTCTCATTCTTACTTTTTTCTTAGCGGGAACTCCCG
CTCTCATTAAATCCTTTGAAGATATTCTGGATAGAACCGTAAACATTGAT
ATTCTCATGACATCGGCAGCCTTTGGTTCTATCTTCATTGGAGGGGCTTT
GGAAGGAGCTTTGCTCTTGGTCCTCTTTGCCATCTCAGAATCCTTAGGAG
CGATGGTCTCCGGAAAGGCTAAAAGTACTCTCGCTTCCTTAAAACATTTA
GCACCCACTGTAGCTTGGGTCGTTCAGCAAGACGGATCCCTGCAAAAAGT
TTTAGTGCAAAACGTCAAAGTTGGAGAAATTATCCGAGTAAAAAGCGGAG
AGGTTGTTCCTTTAGATGGGAAAATTATTCAAGGAGCCTCTTCTATTAAT
CTCATGCATCTAACTGGAGAAAAGATCCCTAAATCTTGTGGCATTGGGGA
TACTATTCCTGCAGGGGCTCATAACTTAGAAGGGAGCTTTGATCTCCAGG
TCCTCCGCATCGGTGCAGAATCCACGATTGCTCATATCATCAATCTGGTT
GTTCAAGCGCAAAGCTCCAAACCTAAATTACAACAACGTTTGGACCGCTA
TTCATCAACATATGCTCTAACCATCTTCGCTATCTCAGCATGTATAGCTA
TAGGAGGCTCTCTATTCACAACACTGCCTTTCCTCGGACCAGACAGTGCC
TTTTACCGCGCTCTAGCATTTTTAATTGCAGCTTCTCCCTGTGCTCTTAT
CATAGCTATTCCAATTGCTTATCTTAGCGCTATTAATGCTTGTGCTAAAC
ATGGTGTCTTGCTTAAGGGCGGCGTAGTCTTAGATCGTCTAGTCTCCTGC
AATTCTGTAGTTATGGATAAGACGGGAACGCTTACTACAGGAGATTTAAC
CTGTTCAGGATGCGAAGATTTTGGTCCAGAATCGCCTCTGTTTTATTCTT
GCGTATTGGCTATGGAGCAGTCGTCCTCTCATCCTATTGCTCAAGCCATT
GTCAACTACCTCACTGAGAAGCAAGTTCGGTCGCTACCAGCGACACAATG
CACAACGATACCAGGAGAGGGCGTAAGCGGAGAATTTAACGGAGAACAAG
CCTTTGTAGGGCGCGTCTCGACGGCGCTACGTTACGTTCCTGAAGAATAC
CGTGAACAGCTTCGCGAACGCGCTCAGCAAGCTCAAGAACGCGGCGACAC
ATGTTCTATAGCTTGCTTAGGCAAACGTGTTTCCCTTTTCTATTTCCGGG
ATGTCCCACGCCACGATGCTGCAGATATCGTATCCTATTTGAAAAAGAAT
GGGTATCCTGTATGTATGCTCACAGGAGACCATCGTATCAGCGCCGAAAA
TACAGCTCGACTTCTGGGTATCGATGAAGTGTTCTACGACCTGACTCCTG
ATAACAAGCTCTCGAAAATTCAAGAACTTGCTAAATCACGGCAGATCATG
ATGATAGGAGATGGCATCAATGACGCTCCCGCTTTGGCTCAGGCTACTGT
AGGAATCGCCATGGGAGAAGCTGGAAGCGCAACAGCAATAGAAGCCGCGG
ATGTGGTGCTTTTAAACCAAGGGCTTTCTTCTCTCCCTTGGCTTATTGAT
AAAGCAAAGAAAACTCGTCGGATTGTTTCGCAAAATCTTGCTTTAGCTCT
AGCAATTATTTTATTTATTTCAGGACCAGCATCGATGGGAGTGATCCCCC
TATGGCTTGCTGTGATTTTGCATGAAGGGAGCACCGTGATCGTGGGACTT
AACGCTCTTCGCCTTTTAAAAAACACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy