Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR598 IGR600 IGR597 IGR601 IGR599 IGR596 IGR594 IGR595 CT728 nifU, - CT720 fliF, - CT719 rodA, - CT726 nifS,yfhO, - CT721 serS, - CT729 zntA,cadA, - CT727 CT724 birA, - CT725 yjbC, - CT723 CT728 nifU, - CT720 fliF, - CT719 rodA, - CT726 nifS,yfhO, - CT721 serS, - CT729 zntA,cadA, - CT727 CT724 birA, - CT725 yjbC, - CT723 CT728 nifU, - CT720 fliF, - CT719 rodA, - CT726 nifS,yfhO, - CT721 serS, - CT729 zntA,cadA, - CT727 pgmA,gpmA, - CT722 pgmA,gpmA, - CT722 CT724 birA, - CT725 yjbC, - CT723
* Calculated from Protein Sequence

Gene ID: CT725

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
birA  

Definition:
biotin [acetyl-CoA-carboxylase] ligase (bifunctional repressor/synthetase)

Gene Start:
836231

Gene Stop:
836782

Gene Length:
552

Molecular Weight*:
20349

pI*:
5.16

Net Charge*:
-3.66

EC:
6.3.4.15  

Functional Class:
cofactor biosynthesis; biotin and lipoic acid  

Pathway: pathway table
Biotin metabolism

Comment:
Forms biotinyl-5'-adenylate and transfers the biotin moiety to proteins (biotinylation).


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to biotin [acetyl-CoA-carboxylase] ligase proteins, e.g., 27% similarity to BIRA_PARDE, 25% similarity to BIRA_BACSU.
CT725 is weakly similar to TP0357, a predicted biotin--acetyl CoA --carboxylase ligase in T.pallidum. No similarity to M.genitalium.

CT725 is orthologously related to CPn0866: residues 1-178 are 55% similar to CPn0866.


COGS Summary:  COGS Search
BeTs to 14 clades of COG0340
COG name: Biotin-(acetyl-CoA carboxylase) ligase
Functional Class:  H
The phylogenetic pattern of COG0340 is amtkyqvcebrhuj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 31-115, 8-116 are 37%, 33% similar to a Biotin-Acetyl-COA carboxylase synthetase biotin domain as seen in BIRA_BACSU. Residues 67 to 113 are 29% similar to a CII regulatory CI domain as seen in RPC1_BPP22. Residues 161 to 175 are 40% similar to a CII regulatory CI domain as seen in RPC1_BPP22.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 8 to 139 (E-value = 6.6e-36) place CT725 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

PDB Hit:
gi|442676|pdb|1BIA| Bira Bifunctional Protein (Acts As Biotin Operon Repressor And Biotin Holoenzyme Synthetase) (E.C.6.3.4.15)

Gene Protein Sequence:
MKEIYYEIARTESTNTTAKEGLSLWDPYALTVITTREQTAGRGKFGRVWH
STDQDLLASFCFFLSVNNVDSALLFRIGTEAVMRLGESLGIQEAVMKWPN
DVLVQGKKLSGVLCETIPVKTGTCVIIGIGVNGNVGADELLGIDQPATSL
QELIGRPVDMEEQLKRLTKEIKHLIQTLPLWGRE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAAATCTATTATGAAATAGCACGTACGGAATCAACGAATACGAC
AGCAAAAGAGGGGCTTTCTTTGTGGGATCCCTATGCTCTCACAGTGATCA
CGACCAGAGAACAAACGGCGGGAAGAGGGAAATTTGGAAGGGTCTGGCAC
TCCACAGATCAAGATCTTTTGGCTTCGTTTTGTTTCTTTTTAAGTGTGAA
TAATGTGGACAGTGCTTTGTTATTTCGTATAGGGACAGAAGCCGTGATGC
GTCTCGGGGAATCGTTAGGCATTCAAGAAGCTGTCATGAAATGGCCTAAC
GACGTGTTAGTTCAGGGGAAAAAACTTTCAGGAGTGTTGTGTGAGACCAT
CCCTGTTAAGACTGGAACGTGTGTCATTATTGGTATCGGTGTGAATGGTA
ATGTGGGTGCTGATGAATTGCTAGGTATTGATCAGCCTGCAACGTCTCTC
CAGGAATTGATAGGGAGGCCTGTAGATATGGAAGAACAGCTTAAGCGGCT
CACGAAAGAAATCAAGCATCTTATCCAGACGCTACCGTTATGGGGGCGAG
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy