Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR593 IGR591 IGR588 IGR589 IGR592 IGR590 IGR594 CT718 nifU, - CT720 fliF, - CT719 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT712 CT711 CT718 nifU, - CT720 fliF, - CT719 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT712 CT711 CT718 nifU, - CT720 fliF, - CT719 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT716 CT716 CT712 CT711
* Calculated from Protein Sequence

Gene ID: CT715

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
UDP-glucose phosphorylase

Gene Start:
828417

Gene Stop:
827053

Gene Length:
1365

Molecular Weight*:
51410

pI*:
6.40

Net Charge*:
-4.89

EC:
2.7.7.9  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
A potential glucosyl donor in several pathways: pentose, galactose, nucleotide sugars, etc.

See the comment to CT714.

Blast Summary:  PSI-Blast Search
Numerous hits in Psi-BLAST to UDP glucose pyrophosphorylase proteins, e.g., 21% similarity to UTP--glucose-1-phosphate uridylyltransferase in Hordeum vulgare (JC4785), 29% similarity to an unknown protein in Arabidopsis thaliana.
No similarities to T.pallidum or M.genitalium.
CT715 is orthologously related to CPn0856: residues 1-455 are 63% similar to CPn0856.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 21 to 452 are 29% similar to a hypothetical 53.5 KD protein domain as seen in QRI1_YEAST.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 45 to 440 (E-value = 3e-08) place CT715 in the UDPGP family which is described as UTP--glucose-1-phosphate uridylyltransferase (PF01704)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
220

PDB Hit:
none

Gene Protein Sequence:
MTDSSYVDLSFLLDQLLPIQQEHLLEYWPSLSPQQRLRLGTQIAQIDIPF
FLRQQALLQNPQASHQEYTPLSPVHYAGDNPAYAQLGFQLLQRGKVGCVV
LAGGQGSRLKFDGPKGLYPVSSVKKKPLYQLVAEKVAAASKWVGRPLPLA
IMTSPLNHKQTLSYFATNDYFNLSPSQVDFFCQPLWPLLSLSGDLFLESE
DRLSLGPTGNGCLSTLLQSSGIWDKWHQAGIEMVSVIPIDNPLALPFDRE
LVGFHAAEHNDVTIKTTLRQSAQEDVGVLIELAKQKIAVVEYSTLTTKER
CVKTTEGDLTYKLANIGLYCLSMDFLAQTAYQPLPLYKANKHAKQLHPST
TEKNAWKFEEFIFDLFQYSEHSQAIVYPRHECFAPLKNYEGNHSPATVRE
AMRKREHALFTAVTERKLSPNTIFELEADFYYPSSHTSLEWETKIFFQET
IIEAS

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGACTCCTCGTATGTAGATTTATCATTTCTATTGGATCAGCTGCT
TCCTATTCAACAGGAGCATTTATTAGAGTATTGGCCTTCGTTATCCCCTC
AACAAAGGCTACGGTTAGGCACTCAAATCGCTCAAATCGATATTCCTTTT
TTTCTTCGTCAGCAAGCGTTACTACAAAATCCTCAAGCCTCTCATCAAGA
ATATACTCCCTTATCCCCTGTACACTATGCTGGCGACAACCCTGCTTATG
CCCAGCTGGGCTTCCAGCTATTGCAAAGAGGTAAGGTTGGTTGCGTCGTA
TTAGCTGGTGGCCAAGGATCGCGATTAAAATTTGATGGGCCCAAAGGGCT
CTATCCTGTTTCCTCTGTAAAGAAAAAACCTCTTTATCAACTAGTTGCAG
AGAAGGTAGCCGCGGCTAGCAAATGGGTAGGGAGACCATTGCCATTAGCG
ATTATGACCTCCCCTCTTAATCATAAACAGACCCTCTCTTACTTTGCTAC
TAACGACTATTTTAATTTGTCTCCCTCCCAAGTAGATTTTTTTTGCCAGC
CGCTCTGGCCTCTCCTTTCTTTATCCGGAGATCTGTTCCTAGAATCTGAA
GATCGTCTATCTCTCGGACCTACAGGGAATGGCTGTCTATCCACATTATT
ACAATCTTCAGGAATCTGGGATAAATGGCATCAAGCAGGGATAGAAATGG
TTAGTGTAATCCCTATAGATAATCCCTTAGCATTGCCTTTTGATAGAGAA
CTCGTTGGCTTTCATGCAGCGGAACACAATGATGTCACTATCAAAACTAC
TTTACGACAAAGTGCACAAGAAGATGTCGGAGTCTTAATCGAATTAGCAA
AACAAAAAATTGCAGTTGTTGAATACTCCACACTCACTACTAAAGAACGT
TGCGTGAAAACTACAGAGGGAGATCTCACCTATAAACTCGCAAATATCGG
CTTGTACTGTCTATCTATGGACTTTCTAGCGCAAACAGCATACCAACCTC
TTCCTCTTTACAAAGCGAATAAACATGCTAAGCAATTACATCCCTCTACC
ACTGAAAAAAATGCTTGGAAGTTCGAAGAATTTATTTTTGATTTGTTCCA
ATATAGCGAACACAGTCAAGCCATTGTATATCCTCGCCACGAATGCTTTG
CTCCTCTCAAAAACTATGAAGGGAACCATAGCCCTGCAACAGTTCGAGAA
GCTATGCGCAAAAGAGAACATGCTCTATTTACTGCTGTTACGGAAAGAAA
ACTTTCTCCAAATACAATATTTGAATTAGAAGCGGATTTTTATTACCCTT
CCTCCCATACTTCCTTAGAGTGGGAAACTAAGATATTTTTCCAGGAAACA
ATTATTGAGGCCTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy