Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR593 IGR591 IGR588 IGR589 IGR592 IGR590 CT718 fliF, - CT719 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT712 CT711 CT718 fliF, - CT719 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT712 CT711 CT718 fliF, - CT719 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT716 CT716 CT712 CT711
* Calculated from Protein Sequence

Gene ID: CT714

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gpsA  gpdA  

Definition:
glycerol-3-phosphate dehydrogenase

Gene Start:
827053

Gene Stop:
826052

Gene Length:
1002

Molecular Weight*:
36124

pI*:
8.11

Net Charge*:
4.17

EC:
1.1.1.8  1.1.1.94  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Comment:
The intergenic spacing between CT713 and CT714 is 135 bp.
CT715 overlaps with CT714 (The stop codon of CT715 overlaps with the start codon of CT714, ATGA).
The intergenic spacing between CT715 and CT716 is 14 bp.
CT717 overlap with CT716 (3 bp).
The intergenic spacing between CT717 and CT718 is 76 bp.
The translational coupling and compact intergenic spacing from CT717 to CT714 suggest the possibility of a single transcriptional unit.

From Prosite PDOC00740:

NAD-dependent glycerol-3-phosphate dehydrogenase (EC 1.1.1.8) (GPD) catalyzes the reversible reduction of dihydroxyacetone phosphate to glycerol-3-phosphate. It is a eukaryotic cytosolic homodimeric protein of about 40 Kd. As a signature pattern we selected a glycine-rich region that is probably involved in NAD-binding.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glycerol-3-phosphate dehydrogenase proteins, e.g., 26% similarity to GPDA_MOUSE, 26% similarity to GPDA_MOUSE.
CT714 is similar to TP1009, a predicted glycerol-3-ph dehydrogenase in T.pallidum.
No similarity to M.genitalium.

CT714 is orthologously related to CPn0855 and
they share 72% similarity.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0240
COG name: Glycerol 3-phosphate dehydrogenase
Functional Class:  C
The phylogenetic pattern of COG0240 is a-t-YqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 5-24, 119-153, 115-149, 181-226, 236-257, are significantly matched to BL00957A, D, E, F, concerned with NAD-dependent glycerol-3-phosphate dehydrogenase proteins, e.g. GPDA_CUPLA and GPDB_SCHPO. Residues 4-26 are significantly matched to PR00420A, concerned with aromatic-ring hydroxylase signature proteins, e.g. PSEHBH and PHHY_PSEAE. Residues 4-26 are significantly matched to PR00419A, concerned with adrenodoxin reductase family signature, e.g. ADRO_BOVIN and ADRO_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 51 to 285 are 39% similar to a glycerol-3-phosphate dehydrogenase domain as seen in GPDA_HAEIN. Residues 5 to 40 are 44% similar to a glycerol-3-phosphate dehydrogenase domain as seen in GPDA_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 4 to 324 (E-value = 1.4e-161) place CT714 in the NAD_Gly3P_dh family which is described as NAD-dependent glycerol-3-phosphate dehydrogenase (PF01210)

PDB Hit:
none

Gene Protein Sequence:
MKETIAYLGMGMWGFSLANLLANNGHRVVGWARNPALIEQLSVQRRHPAA
PHISIPQNLSFTSHMEEALDGATMIVEGVTSAGMRPVLTQLKALTELRVP
LVITSKGIEQNTGLLLSEIALEIFGRPAAQHLGYLSGPSIASEVLRGCPC
SVVISAYNPDTLKQIHRAFLTPTFRVYPNSDLKGVALGGALKNVIAIACG
ISDGFRFGDNAKSGLVTRGLHEIRKFATIMGCRPDTLNGLAGLGDLCTTS
FSAFSRNTLFGKLLAEGLTPEQAKTKIGMVVEGVYTALSAHQIATHHRID
MPITTSVYRVLYENLDIQEGIAQLLQRDTKEEYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAGACTATAGCCTACCTAGGAATGGGCATGTGGGGATTTTCCCT
CGCCAATCTTCTTGCTAATAATGGTCATCGTGTAGTGGGATGGGCAAGAA
ACCCTGCACTGATCGAACAGTTGTCTGTGCAACGTCGACACCCAGCAGCT
CCTCATATCTCCATTCCTCAGAATCTTTCTTTCACATCCCACATGGAAGA
AGCTCTAGATGGAGCGACGATGATTGTAGAAGGAGTGACCTCAGCAGGAA
TGAGACCTGTTCTAACACAACTCAAAGCTTTGACAGAGCTTCGCGTTCCT
CTAGTAATCACATCAAAAGGTATCGAACAAAATACAGGCTTACTCCTAAG
CGAAATCGCTTTAGAAATATTTGGCCGTCCCGCCGCGCAACATCTAGGCT
ATCTCAGTGGGCCCTCTATTGCCAGTGAAGTCCTTCGTGGATGCCCTTGC
TCAGTTGTTATCAGTGCGTATAACCCTGATACTCTAAAACAAATTCATCG
AGCTTTTCTCACCCCTACATTTCGTGTCTATCCTAATAGCGACCTAAAAG
GAGTTGCGTTAGGAGGAGCACTGAAAAATGTAATCGCCATAGCTTGTGGA
ATCTCTGACGGATTCCGCTTCGGGGATAATGCTAAATCTGGACTTGTTAC
CCGAGGTCTGCATGAAATTCGTAAATTTGCCACCATCATGGGATGCCGTC
CAGATACCTTGAATGGGCTCGCAGGTCTAGGAGACCTCTGTACCACCAGC
TTTTCTGCTTTCAGTAGAAATACCCTCTTTGGGAAATTGCTAGCCGAAGG
CCTGACTCCTGAACAGGCTAAAACAAAAATTGGTATGGTGGTCGAAGGGG
TGTACACGGCTCTCTCTGCTCATCAAATTGCTACACACCACAGAATAGAC
ATGCCGATTACCACCAGCGTCTATCGCGTTCTCTACGAAAATCTCGATAT
TCAGGAAGGGATCGCTCAGCTTCTCCAACGTGATACAAAAGAAGAATATT
TG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy