Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR591 IGR588 IGR589 IGR587 IGR590 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 mreB, - CT709 CT712 pckA, - CT710 CT711 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 mreB, - CT709 CT712 pckA, - CT710 CT711 gpsA,gpdA, - CT714 ompB, - CT713 fliI, - CT717 CT715 CT716 CT716 mreB, - CT709 CT712 pckA, - CT710 CT711
* Calculated from Protein Sequence

Gene ID: CT712

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
823696

Gene Stop:
824865

Gene Length:
1170

Molecular Weight*:
43997

pI*:
5.07

Net Charge*:
-10.33

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
The intergenic spacing between CT711 to CT712 is 29 bp.
The intergenic spacing between CT712 to CT713 is 31 bp with tail to tail orientation.

Blast Summary:  PSI-Blast Search
CT712 is orthologously related to CPn0853: residues 4-389 of CT712 are 48% similar to residues 2-385 of CPn0853, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. CT712 is also similar to CPn0726, CPn0727, CPn0852, all Chlamydia-specific hypothetical proteins from C. pneumoniae. Residues 39-284 are weakly similar (21%) to a receptor for hyaluronan-mediated motility from Rattus norvegicus (U87983).
No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 323-332 are significantly matched to block BL00911C, concerned with dihydroorotate dehydrogenase proteins, e.g. PYRD_DROME and PYDB_LACLC. Residues 268-287, 44-59 are matched to blocks PR00655A, E, concerned with auxin binding protein signature, e.g. ABP1_MAIZE and ABP1_TOBAC.


ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
The following paralogous relationships are significant: CT619, CT620, CT711, and CT621, all of which are Chlamydia-specific hypothetical proteins.

Pfam Summary:  Pfam Search
Residues 1 to 390 (E-value = 2.5e-191) place CT712 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
56  
123
coil-coil  
206  
254

PDB Hit:
None.

Gene Protein Sequence:
MRNHPIPEGQKYFVPTIETAAPRERRVSPAEVAADYTQLHEAATYLQVFQ
DLLNDAHQLGLNKEFVESLRQDFLKTGSEMSLMQALWTEESQREARKRER
KELQQQLESKVLGPQALTTAEELHPVDDSIVNKMPFQSAFAYILLDKYIP
AQEEALYALARELSFSGYAQTLFSPVLELVKSFNNAPIVYNLGSYIGQTA
GTANFKYGYQMVLDRYETETGQLRKDIKNAENAKQQLAQIIKNIEANNSL
TTEHKTQLKDMANGYIQTLDVCISQMQELSTGLRGLSFIPGRDEYSPAYE
IMGSSFSVVTLQNLEGKVVDGEINISSGETKGGLLNFFTYFLADVQNFGD
LAQTNQLMLELQMRAMHQQWSLVTASLKLLHNVYRTLASS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAACCATCCGATTCCAGAAGGACAAAAGTATTTTGTTCCAACAAT
AGAGACTGCGGCTCCTCGAGAACGCAGAGTCTCCCCTGCAGAAGTAGCAG
CCGACTACACGCAGTTGCATGAGGCGGCAACGTATCTTCAAGTATTTCAA
GATTTATTGAACGATGCGCATCAGTTAGGACTAAATAAAGAGTTCGTAGA
GAGTTTGCGTCAAGATTTCTTAAAAACAGGCTCCGAGATGTCTTTGATGC
AAGCTCTATGGACTGAAGAGAGTCAAAGAGAAGCGCGTAAGAGAGAGAGA
AAAGAGCTCCAGCAACAACTAGAGTCCAAGGTACTAGGTCCTCAGGCATT
AACGACTGCTGAGGAGTTGCATCCTGTGGATGATAGTATTGTGAATAAGA
TGCCTTTTCAATCGGCTTTTGCGTATATCCTTCTTGATAAGTATATTCCT
GCACAGGAAGAGGCTCTGTATGCATTAGCAAGAGAGCTCAGTTTTTCAGG
GTATGCACAGACATTATTTAGCCCAGTTTTAGAGTTAGTGAAAAGTTTTA
ATAACGCGCCTATCGTTTACAACTTAGGCTCTTACATTGGGCAGACAGCA
GGAACTGCGAACTTTAAATATGGCTATCAGATGGTCTTGGATCGTTATGA
AACAGAGACTGGCCAGTTGAGAAAGGATATTAAAAATGCTGAGAATGCCA
AGCAGCAGCTGGCACAGATTATTAAGAACATAGAGGCAAATAATTCTTTA
ACGACAGAGCACAAGACTCAGCTCAAGGATATGGCAAATGGGTATATTCA
GACTTTAGATGTCTGTATCTCCCAAATGCAAGAGCTGTCTACTGGATTGC
GAGGATTATCATTTATCCCTGGTAGAGATGAATACAGCCCTGCTTATGAG
ATTATGGGATCTTCTTTTTCCGTAGTTACTTTACAAAACTTGGAAGGGAA
GGTTGTCGATGGGGAGATCAATATTTCCTCTGGAGAAACGAAAGGTGGGC
TTTTAAACTTCTTTACCTATTTTCTTGCAGACGTACAGAATTTTGGAGAT
TTAGCACAAACGAATCAGTTGATGTTAGAACTACAAATGCGAGCTATGCA
TCAGCAATGGAGTTTAGTTACAGCCTCTCTGAAACTCTTACATAATGTAT
ATAGAACATTGGCTTCTAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy