Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR586 IGR588 IGR589 IGR587 IGR590 gpsA,gpdA, - CT714 ompB, - CT713 CT715 mreB, - CT709 CT712 pckA, - CT710 CT711 snf,mot1, - CT708 gpsA,gpdA, - CT714 ompB, - CT713 CT715 mreB, - CT709 CT712 pckA, - CT710 CT711 snf,mot1, - CT708 gpsA,gpdA, - CT714 ompB, - CT713 CT715 mreB, - CT709 CT712 pckA, - CT710 CT711 snf,mot1, - CT708
* Calculated from Protein Sequence

Gene ID: CT711

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein (acidic)

Gene Start:
821366

Gene Stop:
823666

Gene Length:
2301

Molecular Weight*:
86121

pI*:
4.62

Net Charge*:
-26.28

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT711 is orthologously related to CPn0852: residues 1-767 are 39% similar to residues 1-765 of CPn0852, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. CT711 is also similar to CPn0727, CPn0853, CPn0726, all Chlamydia-specific hypothetical proteins. No similarities to T. pallidum or M. genitalium.


COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 261-297, 4-40 are matched to block BL00538D, concerned with bacterial chemotaxis sensory transducer proteins, e.g. MCP2_ECOLI. Residues 406-416, 249-259 are matched to block PR00307A, concerned with adenovirus fibre protein signature, e.g. FIBP_ADE12. Residues 695-706 are matched to block BL00655D, concerned with glycosyl hydrolases family 6 proteins, e.g. GUN2_THEFU. Residues 586-606 are matched to block BL01126A, concerned with elongation factor TS proteins., e.g. EFTS_HAEIN .





ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
This protein is paralogously related to four other C. trachomatis proteins:
CT620, CT621, CT619, and CT712 all of which are hypothetical proteins. Scores range from 120 (CT620) to 92 (CT712)
with the match to itself receiving a score of 1509.

Pfam Summary:  Pfam Search
Residues 371 to 765 (E-value = 5.6e-204) place CT711 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
125
coil-coil  
133  
160
coil-coil  
581  
619

PDB Hit:
None.

Gene Protein Sequence:
MSIQPTSISLTKNITAALAGEQVDAAAVYMPQAVFFFQQLDEKSKGLKQA
LGLLEEVDLEKFIPSLEKSPTPITTGTTSKISADGIEIVGELSSETILAD
PNKAAAQVFGEGLADSFDDWLRLSENGGIQDPTAIEEEIVTKYQTELNTL
RNKLKQQSLTDDEYTKLYAIPQNFVKEIESLKNENNVRLIPKSKVTNFWQ
NIMLTYNSVTSLSEPVTDAMNTTMAEYSLYIERATEAAKLIREITNTIKD
IFNPVWDVREQTGIFGLKGAEYNALEGNMIQSLLSFAGLFRQLMSRTATV
DEIGALYPKNDKNEDVIHTAIDDYVNSLADLKANEQVKLNGLLSLVYAYY
ASTLGFAKKDVFNNAQASFTDYTNFLNQEIQYWTPRETSSFNISNQALQT
FKNKPSADYNGVYLFDNKGLETNLFNPTFFFDVVSLMTADPTKTMSRQDY
NKVITASESSIQKINQAITAWELAIAECGTKKAKLEPSSLNYFNAMVEAK
KTFVETSPIQMVYSSLMLDKYLPNQQYILETLGSQMTFSNKAARYLNDII
AYAVSFQTADVYYSLGMYLRQMNQQEFPEVISRANDTVKKEIDRSRADLF
HCKKAIEKIKELVTSVNADTELTSSQRAELLETLASYAFEFENLYHNLSN
VYVMVSKVQISGVSKPDEVDEAFTAKIGSKEFDTWIQQLTTFESAVIEGG
RNGVMPGGEQQVLQSLESKQQDYTSFNQNQQLALQMESAAIQQEWTMVAA
ALALMNQIFAKLIRRFK

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCAATACAACCTACATCCATTTCTTTAACTAAGAATATAACGGCAGC
TTTAGCCGGAGAGCAGGTCGATGCTGCTGCAGTGTATATGCCGCAGGCTG
TTTTTTTCTTTCAGCAACTGGATGAAAAAAGCAAGGGGCTGAAACAGGCT
TTAGGATTGCTCGAAGAGGTTGATCTAGAAAAATTTATACCGTCTTTAGA
AAAATCACCTACACCTATCACTACGGGAACAACGAGTAAAATTTCCGCTG
ATGGGATTGAGATTGTTGGAGAGCTTTCTTCAGAAACAATTTTGGCAGAT
CCTAATAAAGCTGCAGCTCAGGTTTTTGGAGAGGGGCTTGCAGATAGTTT
TGATGATTGGCTCAGATTATCTGAAAATGGGGGGATTCAAGATCCTACAG
CAATAGAAGAAGAGATTGTTACTAAGTATCAAACAGAACTCAATACTCTG
CGCAATAAACTCAAGCAACAATCTTTAACAGACGATGAGTATACGAAGCT
TTATGCTATTCCTCAAAACTTTGTTAAAGAGATAGAAAGCTTAAAGAATG
AAAATAATGTGAGGTTAATTCCCAAAAGTAAAGTCACTAACTTTTGGCAG
AATATCATGCTCACTTACAACTCGGTAACCTCGTTATCAGAACCTGTTAC
CGATGCGATGAATACGACTATGGCGGAGTACTCTCTTTATATTGAGAGAG
CTACAGAGGCTGCCAAGTTGATACGGGAGATAACCAACACGATCAAAGAC
ATTTTCAATCCAGTTTGGGATGTGCGTGAACAAACAGGAATTTTTGGGTT
AAAAGGAGCTGAGTATAACGCTTTAGAAGGCAATATGATTCAAAGCTTGC
TTAGCTTTGCGGGTCTATTCCGGCAGTTAATGAGTCGTACTGCAACAGTT
GATGAGATAGGCGCACTTTATCCTAAAAATGATAAAAACGAAGACGTCAT
TCATACTGCTATTGATGATTATGTGAATTCTTTAGCTGATTTGAAAGCCA
ATGAACAGGTCAAACTCAACGGTCTGTTGAGTTTAGTATATGCTTATTAT
GCTAGTACTTTAGGTTTTGCTAAGAAGGATGTATTCAATAATGCACAAGC
TTCTTTTACAGATTATACTAATTTTCTAAACCAAGAGATCCAATATTGGA
CGCCTAGAGAGACTTCAAGTTTTAATATCTCCAATCAAGCATTGCAAACC
TTTAAAAATAAGCCTTCGGCTGATTATAACGGCGTATATCTTTTTGATAA
TAAAGGATTAGAGACTAATCTCTTTAATCCTACGTTCTTCTTTGATGTTG
TGAGTCTCATGACAGCTGATCCTACGAAGACTATGTCTCGACAGGATTAC
AATAAGGTGATTACAGCCTCGGAATCCAGTATTCAGAAGATTAATCAGGC
TATTACCGCTTGGGAACTAGCTATTGCAGAATGTGGGACTAAAAAAGCGA
AGCTCGAACCATCCAGTTTAAATTATTTTAATGCTATGGTCGAAGCGAAG
AAGACCTTCGTAGAGACCTCTCCAATACAGATGGTCTATTCATCTTTGAT
GTTGGATAAGTATCTTCCGAATCAGCAGTACATATTAGAGACATTAGGAA
GTCAGATGACTTTCTCTAACAAGGCTGCTCGGTATTTAAATGATATCATT
GCGTATGCAGTTAGCTTCCAAACAGCTGACGTCTATTATTCTTTAGGGAT
GTATCTTCGACAAATGAACCAGCAGGAATTTCCTGAGGTGATTTCTCGTG
CTAACGATACTGTGAAAAAAGAGATAGATCGGAGTCGTGCGGATCTCTTT
CACTGTAAAAAAGCTATCGAAAAGATTAAAGAATTAGTGACTTCTGTAAA
TGCGGATACTGAATTGACCTCATCTCAGCGTGCAGAGTTATTAGAGACGT
TAGCTAGTTATGCTTTTGAATTTGAGAATCTCTATCACAACCTCTCTAAT
GTTTACGTCATGGTTTCTAAGGTACAGATTTCTGGCGTAAGCAAGCCTGA
TGAAGTGGATGAGGCTTTTACTGCTAAGATTGGATCGAAGGAATTCGATA
CTTGGATTCAGCAGCTTACAACATTTGAAAGTGCTGTGATTGAAGGTGGG
CGTAATGGTGTGATGCCTGGGGGAGAGCAGCAGGTTTTACAGAGTTTAGA
GAGCAAGCAGCAAGATTACACGTCGTTCAACCAGAATCAGCAATTAGCTC
TACAAATGGAGTCCGCAGCGATTCAACAAGAGTGGACTATGGTAGCAGCA
GCCTTAGCATTAATGAATCAGATTTTTGCTAAGTTGATCCGTAGATTTAA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy