Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR586 IGR588 IGR589 IGR587 ompB, - CT713 mreB, - CT709 CT712 pckA, - CT710 CT711 snf,mot1, - CT708 ompB, - CT713 mreB, - CT709 CT712 pckA, - CT710 CT711 snf,mot1, - CT708 ompB, - CT713 mreB, - CT709 CT712 pckA, - CT710 CT711 snf,mot1, - CT708
* Calculated from Protein Sequence

Gene ID: CT710

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pckA  

Definition:
phosphoenolpyruvate carboxykinase

Gene Start:
819455

Gene Stop:
821251

Gene Length:
1797

Molecular Weight*:
66237

pI*:
5.65

Net Charge*:
-12.86

EC:
4.1.1.32  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)
Carbohydrate Metabolism; Pyruvate metabolism

Comment:
This enzyme is functional in gluconeogenesis.

See the comment to CT708.

From Prosite PDOC00421:

Phosphoenolpyruvate carboxykinase (GTP) (EC 4.1.1.32) (PEPCK) catalyzes the formation of phosphoenolpyruvate by decarboxylation of oxaloacetate while hydrolyzing GTP, a rate limiting step in gluconeogenesis (the biosynthesis of glucose). In vertebrates there are two isozymes: a cytosolic form whose activity is affected by hormones regulating this metabolic process (such as glucagon, or insulin) and a mitochondrial form.

An essential cysteine residue has been proposed to be implicated in the catalytic mechanism; this residue is located in the central part of PEPCK and is in the center of a perfectly conserved region that we use as a signature pattern.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phosphoenolpyruvate carboxykinase proteins, e.g., 50% similarity to PPCC_RAT, 51% similarity to PPCC_HUMAN.
CT710 is similar to TP0122, a predicted PEP carboxykinase in T.pallidum. No similarity
to M.genitalium.
CT710 is orthologously related to CPn0851: residues 5-599 are 75% similar to CPn0851.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1274
COG name: Phosphoenolpyruvate carboxykinase
Functional Class:  C
The phylogenetic pattern of COG1274 is ---k------r------lin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 60-93, 95-138, 207-250, 139-158, 170-181, 191-222, 239-263, 290-331, 332-354, 364-406, 431-476, 486-523, 195-232, 531-547, are significantly matched to BL00505A-L,concerned with Phosphoenolpyruvate carboxykinase (GTP) proteins, e.g. PPCK_CHLLI, PPCK_NEOFR and PPCK_HAECO.

ProDom Summary:  Protein Domain Search
Residues 17 to 547 are 56% similar to a phosphoenolpyruvate GTP carboxylase carboxykinase domain as seen in PPCK_NEOFR.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MTGDWISKITHSGLKSWIEEVIALVSPDDVRLCDGSEAEYQQLCQQMQDA
GVMTPLNPELHPNCFLVRSSPSDVARAEQFTFICTKTQEEAGPTNNWRDP
QEMRAELHALFRECMRGRTLYIVPFCMGPLNSPFSLIGVEITDSPYVVCS
MKIMTRMGASVLAMLGSNGTFYKCLHSVGKPLAPGEKDVAWPCDPEHMRI
VHFQDDSSVMSFGSGYGGNALLGKKCVALRLASYLGHQQGWLAEHMLIIG
VTNPEGRKKYFAAAFPSACGKTNLAMLMPKLPGWKVECIGDDIAWIRPGN
DGRLYAVNPEFGFFGVALGTSETTNPHALATCYADSLFTNVALTADGDVW
WEGKTTTPPQGMIDWKGRTWVSGGEPAAHPNARFTAPLDHCPSLDPQWNN
PQGVPLEAVIFGGRRTETIPLVYEALSWEHGVMMGAGMSSTTTAAIVGEL
GKLRHDPFAMLPFCGYNMAAYFEHWLSFATKGLQLPRIFGVNWFRKDEHG
QFIWPGFSENLRVLEWIFRRTDGEDAIAHRTPVGYLPTAEGLNTSGLDLS
EDALRALLTVDAQGWKAEVSNIRKYCSIFGADMPQRILEELSRIESELK

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGGCGATTGGATATCTAAGATAACCCACTCAGGATTAAAATCTTG
GATAGAAGAAGTAATTGCTTTGGTGTCACCTGACGACGTAAGGTTATGCG
ATGGTTCAGAAGCCGAATACCAACAGCTTTGCCAGCAGATGCAGGATGCT
GGGGTGATGACCCCTCTAAATCCTGAGCTGCATCCTAACTGCTTCCTCGT
TCGTTCTTCTCCTAGTGATGTCGCTCGTGCTGAACAATTTACTTTTATTT
GTACCAAGACTCAAGAAGAAGCTGGTCCAACAAATAACTGGAGAGATCCT
CAAGAGATGCGTGCAGAGCTGCACGCATTATTCCGAGAGTGTATGCGAGG
TCGCACACTCTACATTGTGCCTTTTTGTATGGGGCCTTTGAACTCTCCAT
TTTCTTTGATTGGTGTTGAGATTACAGACTCTCCTTATGTTGTATGTTCT
ATGAAGATCATGACGCGTATGGGAGCTTCTGTTTTAGCGATGTTGGGTTC
TAATGGGACTTTCTATAAGTGTTTACATAGTGTAGGGAAGCCCTTAGCTC
CTGGAGAGAAAGATGTAGCATGGCCTTGTGATCCTGAGCATATGCGTATT
GTCCATTTCCAAGATGACAGTAGTGTGATGTCTTTTGGTAGCGGATACGG
AGGCAACGCATTGCTAGGTAAGAAGTGCGTAGCTTTGCGTTTAGCTTCTT
ATTTAGGACATCAACAAGGTTGGTTAGCGGAGCATATGTTGATTATTGGG
GTGACTAACCCTGAAGGAAGGAAGAAGTATTTTGCTGCGGCGTTCCCTAG
CGCTTGTGGAAAAACGAATCTTGCTATGTTGATGCCTAAGCTGCCAGGGT
GGAAGGTGGAGTGTATTGGGGATGACATTGCTTGGATTCGTCCTGGTAAT
GATGGGAGATTATACGCAGTGAATCCAGAATTTGGATTTTTTGGAGTGGC
ATTAGGAACTTCAGAGACTACAAATCCTCACGCACTTGCCACTTGTTATG
CGGACTCACTATTCACGAACGTAGCTTTGACTGCTGATGGAGATGTATGG
TGGGAAGGTAAAACTACCACGCCTCCGCAAGGTATGATTGATTGGAAGGG
TCGAACTTGGGTCTCTGGAGGGGAGCCTGCAGCACATCCTAATGCGCGTT
TTACAGCTCCGTTGGATCATTGTCCTTCTTTAGATCCGCAATGGAATAAT
CCTCAAGGGGTTCCTTTAGAGGCGGTCATTTTTGGTGGAAGACGTACAGA
GACCATTCCTTTAGTATATGAGGCGTTAAGCTGGGAGCATGGGGTGATGA
TGGGGGCAGGGATGTCCTCAACGACAACTGCCGCGATTGTAGGGGAGTTG
GGTAAGCTGCGACATGATCCTTTTGCTATGCTTCCATTTTGTGGCTATAA
CATGGCAGCTTATTTCGAGCATTGGTTGTCGTTTGCTACTAAAGGTTTGC
AGTTGCCTAGAATTTTTGGTGTCAACTGGTTCCGTAAGGATGAGCACGGG
CAGTTCATTTGGCCTGGGTTCTCAGAAAATCTTCGTGTATTGGAATGGAT
CTTCCGTCGTACGGATGGAGAGGATGCCATTGCGCACCGTACTCCGGTAG
GATATTTACCTACAGCAGAAGGGCTTAATACATCGGGGCTCGATCTATCC
GAGGATGCTTTGCGAGCTTTGTTGACTGTAGATGCGCAGGGTTGGAAAGC
TGAGGTCAGTAATATTCGGAAGTATTGTTCGATTTTCGGAGCTGATATGC
CACAGCGTATTCTTGAAGAATTATCCAGAATAGAAAGCGAATTGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy