Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR574 IGR575 IGR573 IGR577 IGR578 IGR576 end3, - CT697 thdF, - CT698 psdD, - CT699 CT695 CT696 CT700 secA, - CT701 end3, - CT697 thdF, - CT698 psdD, - CT699 CT695 CT696 CT700 secA, - CT701 end3, - CT697 thdF, - CT698 psdD, - CT699 CT695 CT696 CT700 secA, - CT701
* Calculated from Protein Sequence

Gene ID: CT699

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
psdD  

Definition:
phosphatidylserine decarboxylase

Gene Start:
802134

Gene Stop:
803036

Gene Length:
903

Molecular Weight*:
34063

pI*:
9.80

Net Charge*:
11.36

EC:
4.1.1.65  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:
This protein converts phosphatidylserine to phosphatidylethanolamine.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phosphatidylserine decarboxylase proteins, e.g., 33% similarity to DPSD_CLOPA, 27% similarity to DPS2_YEAST.
CT699 is identical to U72715, a previously published trachomatis phosphatidylserine decarboxylase protein. No similarities
to T.pallidum or M.genitalium.

CT699 is orthologous to CPn0839: residues 8-297 are 52% similar to CPn0839.


COGS Summary:  COGS Search
BeTs to 6 clades of COG0688
COG name: Phosphatidylserine decarboxylase
Functional Class:  I
The phylogenetic pattern of COG0688 is amt-Y---ebrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 86 to 217 are 35% similar to a phosphatidylserine decarboxylase domain as seen in DPS2_YEAST. Residues 220 to 300 are also part of a decarboxlase domain as seen in DPSD_CLOPA.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 90 to 297 (E-value = 3.3e-113) place CT699 in the PS_Dcarbxylase family which is described as Phosphatidylserine decarboxylase (PF02666)

PDB Hit:
none

Gene Protein Sequence:
MAAREMLYVNRETGKVEQERIICSSLVKFFIETRIGRALYSVLCKNSLFS
RIVGWCQRLRVTRYFIKPFVTKYRICIEESASPLHDYASFNDFFVRKLKP
DARPICQGEDICVTPADGAYLVFPSMADLSLFTIKNKPFSLESFLGDPQL
AHQYAQGSMAIARLAPFDYHRFHFPIAGIAEAPRRINGHLFSIHPLMLKR
NFEVFTENKREITIITSKEFGEVAYVEVGALNVGSIHQTFSPGSYVKKGA
EKGFFAFGGSTVVLLFQPQRIIFDADLVGYSAQGLETRCRMGQSLGKRFS
S

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCGCGGGAAATGTTATATGTTAATCGCGAAACAGGGAAGGTGGA
ACAGGAACGTATCATCTGTTCTTCTCTGGTAAAGTTTTTTATTGAAACGA
GAATAGGGAGAGCTCTGTACTCTGTTTTATGTAAGAATAGCCTGTTTTCC
CGTATCGTAGGCTGGTGTCAAAGACTGCGAGTGACGCGATATTTTATTAA
ACCTTTCGTTACAAAATATCGTATTTGCATAGAAGAGAGTGCTTCTCCTC
TGCACGACTACGCGTCATTTAATGATTTTTTTGTACGAAAACTCAAACCA
GATGCTCGACCTATCTGCCAGGGAGAGGATATCTGTGTGACTCCTGCTGA
TGGTGCCTATCTTGTTTTCCCTTCCATGGCAGATCTATCCTTGTTTACCA
TTAAAAATAAGCCGTTTTCTTTAGAAAGTTTTTTAGGGGATCCGCAATTG
GCTCACCAATATGCGCAAGGGAGTATGGCAATCGCTCGATTAGCTCCTTT
TGATTACCATCGCTTCCACTTTCCTATAGCGGGTATTGCTGAGGCACCGC
GCCGTATCAACGGCCATCTTTTTTCTATTCATCCTCTTATGCTTAAGCGG
AATTTCGAAGTGTTTACGGAGAATAAACGCGAAATTACCATAATTACGTC
AAAAGAGTTTGGTGAGGTTGCCTACGTGGAAGTAGGGGCGTTAAATGTGG
GTTCTATCCACCAAACGTTTTCTCCCGGTAGTTATGTGAAAAAAGGTGCC
GAAAAAGGTTTTTTTGCTTTTGGAGGATCGACTGTTGTTCTATTATTTCA
GCCCCAACGGATTATCTTTGATGCAGATCTAGTTGGTTATTCTGCTCAGG
GTTTAGAAACCCGGTGTCGAATGGGACAATCGTTAGGAAAACGTTTCTCT
TCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy