Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR574 IGR569 IGR575 IGR572 IGR573 IGR570 IGR568 IGR571 end3, - CT697 dppD, - CT690 thdF, - CT698 CT691 parB, - CT688 CT694 CT695 pgk, - CT693 CT696 ygo4, - CT692 end3, - CT697 dppD, - CT690 thdF, - CT698 CT691 parB, - CT688 CT694 CT695 pgk, - CT693 CT696 ygo4, - CT692 dppD, - CT690 thdF, - CT698 dppF, - CT689 dppF, - CT689 end3, - CT697 CT691 parB, - CT688 CT694 CT695 pgk, - CT693 CT696 ygo4, - CT692
* Calculated from Protein Sequence

Gene ID: CT693

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgk  

Definition:
phosphoglycerate kinase

Gene Start:
794941

Gene Stop:
796149

Gene Length:
1209

Molecular Weight*:
42985

pI*:
5.90

Net Charge*:
-8.84

EC:
2.7.2.3  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Energy Metabolism; Carbon fixation

Comment:
This enzyme converts biphosphoglycerate to 3-phosphoglycerate.

From Prosite PDOC00102:

Phosphoglycerate kinase (EC 2.7.2.3) (PGK) catalyzes the second step in the second phase of glycolysis, the reversible conversion of 1,3-diphospho-glycerate to 3-phosphoglycerate with generation of one molecule of ATP. PGK is found in all living organisms and its sequence has been highly conserved throughout evolution. It is a two-domain protein; each domain is composed of six repeats of an alpha/beta structural motif. As a signature pattern for PGK's, we selected a conserved region in the N-terminal region.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phosphoglycerate kinase proteins, e.g., 42% similarity to PGK_TRIVI, 46% similarity to PGK_BACST.
CT693 is identical to U83197, a previously published trachomatis 3-phosphoglycerate kinase protein. It is similar to TP0538,
a predicted pgk protein in T.pallidum and to MG300, a predicted pgk protein in
M.genitalium.

CT693 is orthologously related to CPn0679, a predicted Phosphoglycerate Kinase: residues
1-403 are 72% similar to CPn0697.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0126
COG name: 3-phosphoglycerate kinase
Functional Class:  G
The phylogenetic pattern of COG0126 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 10-26, 54-65, 71-94, 110-124, 142-162, 173-219, 239-278, 303-338, 89-124, 354-398, 199-243 are significantly matched to BL00111A, B, C, D, E, F, G, H, I, concerned with Phosphoglycerate kinase proteins, e.g. PGK_CHLTR. Residues 294-304, 221-240 are significantly matched to PR00409A, F, concerned with phthalate dioxygenase reductase family signature proteins, e.g. PDR_BURCE.

ProDom Summary:  Protein Domain Search
Residues 85-388, 14-77 and 371-399 are 93%, 96% and 68% similar to phosphoglycerate kinase domains as seen in PGKH_ARATH and PGKH_SPIOL.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 1 to 402 (E-value = 5.4e-197) place CT693 in the PGK family which is described as Phosphoglycerate kinase (PF00162)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
334  
403

PDB Hit:
gi|3318871|pdb|1VPE| Crystallographic Analysis Of Phosphoglycerate Kinase From The Hyperthermophilic Bacterium Thermotoga Maritima Transferase, Phosphoglycerate Kinase, Thermotoga Maritima, Hyperthermostability, Crystal, Amp-Pnp, 3-Pga Mol_id: 1; Molecul

Gene Protein Sequence:
MDKLSIRDLSLEGKKVLVRVDFNVPIKDGKILDDVRIHSAMPTIHYLLKQ
DAAVILVSHVGRPKGGVFEEAYSLAPIVPVLEGYLGHHVPLSPDCIGEVA
RQAVAQLSPGRVLLLENVRFHKGEEHSDEDPSFAIELAAYADFYVNDAFG
TSHRKHASVYRVPQLFPDRAAAGFLMEKELEFLGQHLLVEPKRPFTAILG
GAKMSSKIGVIEALLSCVDHLVLAGGMGYTFLRAMNRQVGNSLVEESGIP
LAKKVLEKAQALGVKIHLPVDAKVAKQCDSGEDWRELSIQEGIPEGLAGF
DIGAQTIELFSKVIQESATIFWNGPVGVYEVPPFDQGSKAIAQCLASHSS
AVTVVGGGDAAAVVALAGCASQISHVSTGGGASLEFLEKGSLPGTEILSP
AQS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAATTATCGATAAGAGACCTTTCTCTTGAAGGGAAAAAGGTACT
AGTTCGTGTAGATTTTAATGTTCCTATTAAAGATGGAAAGATTTTAGATG
ATGTGCGTATTCATAGCGCAATGCCTACGATCCATTATCTTTTGAAACAA
GATGCAGCAGTCATTTTGGTAAGCCATGTAGGACGCCCAAAGGGAGGCGT
ATTTGAAGAGGCATATTCATTAGCTCCCATTGTTCCTGTGCTAGAGGGGT
ATTTAGGGCATCATGTGCCTCTTTCTCCAGATTGTATAGGAGAAGTCGCG
CGACAGGCGGTCGCGCAACTTTCTCCTGGTAGAGTTCTTCTTTTAGAGAA
TGTACGTTTCCATAAGGGGGAAGAACATTCTGACGAGGATCCTAGTTTTG
CTATTGAGCTTGCTGCTTATGCAGATTTTTATGTGAATGATGCTTTCGGG
ACATCTCATCGTAAGCATGCTTCTGTATATCGGGTGCCACAACTATTCCC
TGACCGGGCAGCCGCAGGCTTCCTTATGGAAAAAGAATTAGAATTTTTGG
GCCAGCATCTATTAGTTGAGCCTAAACGTCCTTTCACTGCTATTTTAGGA
GGCGCGAAAATGTCTTCGAAAATAGGAGTAATCGAGGCGCTACTTTCGTG
CGTGGATCATCTCGTATTAGCTGGGGGTATGGGGTACACCTTTTTAAGGG
CTATGAATCGCCAGGTAGGGAATTCATTAGTGGAAGAATCAGGGATCCCT
TTAGCGAAAAAAGTATTAGAGAAAGCTCAAGCTCTGGGGGTGAAGATCCA
TCTTCCAGTGGATGCGAAGGTCGCTAAACAGTGTGACTCTGGAGAGGATT
GGAGGGAGCTGTCTATACAGGAAGGAATCCCTGAAGGATTAGCAGGTTTT
GATATTGGGGCACAGACAATAGAACTATTTTCTAAGGTGATTCAGGAGTC
GGCAACGATATTTTGGAATGGTCCTGTCGGGGTATACGAAGTCCCTCCTT
TTGATCAAGGATCGAAGGCAATAGCACAATGTCTCGCGAGCCATTCTTCT
GCTGTGACTGTGGTTGGGGGAGGCGATGCGGCTGCTGTAGTAGCTCTTGC
AGGGTGTGCTTCACAGATCTCCCACGTATCTACAGGGGGAGGCGCTTCCT
TAGAATTCTTAGAAAAAGGTAGTCTTCCTGGTACGGAAATACTATCTCCA
GCTCAAAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy