Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Lys-1 tRNA-Glu-1 IGR560 IGR563 IGR561 IGR559 IGR562 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 CT683 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 CT683 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 omp1,ompA, - CT681 CT676 karG, - CT675 CT676 CT683 pbpB, - CT682
* Calculated from Protein Sequence

Gene ID: CT681

DNA Molecule Name:
1  

Genbank ID:
3329133

Gene Name:
omp1  ompA  

Definition:
major outer membrane protein (MOMP)

Gene Start:
780060

Gene Stop:
778882

Gene Length:
1179

Molecular Weight*:
42426

pI*:
4.95

Net Charge*:
-7.69

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Primary Evidence:
Sanchez-Campillo M, Bini L, Comanducci M, Raggiaschi R, Marzocchi B, Pallini V, Ratti G. 1999. Identification of immunoreactive proteins of Chlamydia trachomatis by Western blot analysis of a two-dimensional electrophoresis map with patient sera. Electrophoresis 20(11):2269-79. Medline: 10493131.


Douglas AL, Hatch TP. 1995. Functional analysis of the major outer membrane protein gene promoters of Chlamydia trachomatis. Journal of Bacteriology 177(21): 6286-6289. Medline: 7592396.


Campbell LA, Kuo CC, Grayston JT. 1990. Structural and antigenic analysis of Chlamydia pneumoniae. Infect Immun 58(1):93-7. Medline: 2294060.


Su H, Zhang YX, Barrera O, Watkins NG, Caldwell HD. 1988. Differential effect of trypsin on infectivity of Chlamydia
trachomatis: loss of infectivity requires cleavage of major outer
membrane protein variable domains II and IV. Infect Immun 56(8):2094-100. Medline: 2456271.

For MOMP alignments and secondary structure predictions, see the Analysis/Bacteria/Chlamydia Outer Membrane Proteins (MOMPs) page of this site (http://www.stdgen.lanl.gov/).

Secondary Evidence:
Koehler JE, Birkelund S, Stephens RS. 1992. Overexpression and surface localization of the Chlamydia trachomatis major outer membrane protein in Escherichia coli. Mol Microbiol 6(9):1087-94. Medline: 1588812.

Kaul R, Duncan MJ, Guest J, Wenman WM. 1990. Expression of the Chlamydia trachomatis major outer membrane protein-encoding gene in Escherichia coli: role of the 3' end in mRNA stability. Gene 87(1):97-103. Medline: 2139622.

Collett BA, Newhall WJ, Jersild RA Jr, Jones RB. 1989. Detection of surface-exposed epitopes on Chlamydia trachomatis by immune electron microscopy. J Gen Microbiol 135 (Pt 1):85-94. Medline: 2476526.


Pickett MA, Ward ME, Clarke IN. 1988. High-level expression and epitope localization of the major outer membrane protein of Chlamydia trachomatis serovar L1. Mol Microbiol 2(5):681-5. Medline: 2460720.

Comment:
CT681 is the major outer membrane protein (approximately 40 kDa) for trachomatis (omp1 or ompB); CT713 appears to be a paralog. Among other outer membrane proteins are omp2, or 60 kDa (CT443), omp3, or 9 kDa (CT444), and the 90 kDa family (CT412, CT413, CT414, CT812, CT869, CT870, CT871, CT872, CT874). See U60196, when available.

For a detailed analysis of Chlamydial MOMPs, see the Analysis/Bacteria/Chlamydia Outer Membrane Proteins (MOMPs) page of this site (http://www.stdgen.lanl.gov/).

For phylogenetic analyses the Chlamydial MOMPs, see Kaltenboeck B, et al. 1993, Medline: 8419295. For detection strategies using PCR see Kaltenboeck B, et al. 1992, Medline: 1349899. For details on the response of Chlamydia trachomatis to interferon gamma (IFN-gamma), see Shaw, AC, et al. 1999. Electrophoresis
20(4-5):775-80. Medline: 10344247.

Blast Summary:  PSI-Blast Search
CT681 is orthologously related to CPn0695: residues 1-393 of CT681 are 64% similar to residues 1-389 of CPn0695, a predicted major outer membrane protein (MOMP) from C. pneumoniae. No similarities to T. pallidum or M. genitalium. Numerous hits in gapped BLAST to major outer membrane protein precursors (MOMP), e.g., 62% similarity to OMP1_CHLPN, 62% similarity to OMP1_CHLPS. CT681 is identical to OMPL_CHLTR (M14738) a previously published trachomatis major outer membrane protein (MOMP). Some of the stronger similarities are to accessions: X62918, X62918, X62918, X62920, X62921, M36533, X52557, M33636, L35605, L35606.


COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 21 to 393 constitue a defined MOMP membrane domain as seen in OMPL_CHLTR.

Paralogs:  Local Blast Search
CT681 is paralogously related to CT713, also a major outer membrane protein: residues 16-393 are 19% similar to CT713.

Pfam Summary:  Pfam Search
Residues 1 to 393 (E-value = 4.5e-298) place CT681 in the Chlam_OMP family which is described as Chlamydia major outer membrane protein (PF01308)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
22

PDB Hit:
None.

Gene Protein Sequence:
MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDP
CATWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAKPTTDTGNSAAPST
LTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGATSGYLKGNS
ASFNLVGLFGDNENQKTVKAESVPNMSFDQSVVELYTDTTFAWSVGARAA
LWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKEFPLD
LTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDAD
TIRIAQPKSATAIFDTTTLNPTIAGAGDVKTGAEGQLGDTMQIVSLQLNK
MKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACTCTTGAAATCGGTATTAGTATTTGCCGCTTTGAGTTCTGC
TTCCTCCTTGCAAGCTCTGCCTGTGGGGAATCCTGCTGAACCAAGCCTTA
TGATCGACGGAATTCTGTGGGAAGGTTTCGGCGGAGATCCTTGCGATCCT
TGCGCCACTTGGTGTGACGCTATCAGCATGCGTGTTGGTTACTACGGAGA
CTTTGTTTTCGACCGTGTTTTGAAAACTGATGTGAATAAAGAATTTCAGA
TGGGTGCCAAGCCTACAACTGATACAGGCAATAGTGCAGCTCCATCCACT
CTTACAGCAAGAGAGAATCCTGCTTACGGCCGACATATGCAGGATGCTGA
GATGTTTACAAATGCCGCTTGCATGGCATTGAATATTTGGGATCGTTTTG
ATGTATTCTGTACATTAGGAGCCACCAGTGGATATCTTAAAGGAAACTCT
GCTTCTTTCAATTTAGTTGGATTGTTTGGAGATAATGAAAATCAAAAAAC
GGTCAAAGCGGAGTCTGTACCAAATATGAGCTTTGATCAATCTGTTGTTG
AGTTGTATACAGATACTACTTTTGCGTGGAGCGTCGGCGCTCGCGCAGCT
TTGTGGGAATGTGGATGTGCAACTTTAGGAGCTTCATTCCAATATGCTCA
ATCTAAACCTAAAGTAGAAGAATTAAACGTTCTCTGCAATGCAGCAGAGT
TTACTATTAATAAACCTAAAGGGTATGTAGGTAAGGAGTTTCCTCTTGAT
CTTACAGCAGGAACAGATGCTGCGACAGGAACTAAGGATGCCTCTATTGA
TTACCATGAATGGCAAGCAAGTTTAGCTCTCTCTTACAGACTGAATATGT
TCACTCCCTACATTGGAGTTAAATGGTCTCGAGCAAGCTTTGATGCCGAT
ACGATTCGTATAGCCCAGCCAAAATCAGCTACAGCTATTTTTGATACTAC
CACGCTTAACCCAACTATTGCTGGAGCTGGCGATGTGAAAACTGGCGCAG
AGGGTCAGCTCGGAGACACAATGCAAATCGTTTCCTTGCAATTGAACAAG
ATGAAATCTAGAAAATCTTGCGGTATTGCAGTAGGAACAACTATTGTGGA
TGCAGACAAATACGCAGTTACAGTTGAGACTCGCTTGATCGATGAGAGAG
CAGCTCACGTAAATGCACAATTCCGCTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy