Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-3 tRNA-Lys-1 tRNA-Glu-1 IGR560 IGR558 IGR561 IGR559 IGR562 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 yscC,sctC, - CT674 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 yscC,sctC, - CT674 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 CT676 CT676 yscC,sctC, - CT674 pbpB, - CT682
* Calculated from Protein Sequence

Gene ID: CT680

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs2  

Definition:
30S Ribosomal protein S2

Gene Start:
778509

Gene Stop:
777664

Gene Length:
846

Molecular Weight*:
31114

pI*:
6.67

Net Charge*:
-1.06

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
See the comment to CT677.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 30s ribosomal proteins, e.g., 33% similarity to RR2_SPIOL. CT680 is identical to P71145 RS2_CHLTR, a previously published trachomatis ribosomal protein S2.
CT680 is similar to TP0606 in T.pallidum and to MG070 in M.genitalium,
both S2 sequences.

CT680 is orthologously similar to CPn0696:
residues 4-267 are 66% similar to residues
5-261 of CPn0696.


COGS Summary:  COGS Search
BeTs to 17 clades of COG0052
COG name: Ribosomal protein S2
Functional Class:  J
The phylogenetic pattern of COG0052 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 12-33, 39-60, 163-216 are significantly matched to BL00962A,B,C, concerned with ribosomal protein S2 proteins, e.g. RS2_CHLTR, RR2_ASTLO and RR2_CYACA.


ProDom Summary:  Protein Domain Search
Residues 22-135 and 151-215 are 89% and 95% similar to ribosomal protein S2 domains as seen in RS2_CHLTR.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 12 to 227 (E-value = 3.2e-85) place CT680 in the Ribosomal_S2 family which is described as Ribosomal protein S2 (PF00318)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
107  
156
non-globular  
219  
282

PDB Hit:
none

Gene Protein Sequence:
MEFSCTLTLKELLESGAHFGHQTSRWNPRMKPFIFEEKNGLYIIDLAKTL
AQLKKAVACIQTTIGQEKSILFVGTKKQAKQIIREAAIECGEFFASERWL
GGMLTNMATIRNSVKTLNRIELDLEASNSGLTKKELALLAKRHRKLLNNL
EGVRHMNSLPGLLIVIDPGYERIAVAEAGKLGIPVMALVDTNCDPTPINH
VIPCNDDSMKSIRLIVNVLKDAVIDAKKRLGVEILSPVRPAERPAEEAVE
ELPLPTGEAQDEASSKEGVLLWADIDNCEALK

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAATTTTCCTGCACACTCACTTTAAAAGAACTATTAGAATCCGGGGC
ACATTTTGGGCACCAGACAAGTCGCTGGAATCCCCGAATGAAACCTTTTA
TTTTTGAAGAAAAAAATGGTCTTTACATCATCGACTTGGCTAAGACTTTG
GCCCAGTTGAAAAAGGCTGTTGCTTGCATTCAAACAACTATTGGACAAGA
GAAATCTATTTTGTTTGTTGGAACAAAAAAACAAGCAAAACAGATCATTA
GAGAAGCTGCGATCGAATGCGGTGAATTCTTTGCTTCGGAGAGATGGTTG
GGCGGCATGTTGACCAACATGGCAACCATTAGAAACTCTGTGAAGACATT
GAATAGAATTGAATTGGATCTTGAGGCTTCTAATTCTGGTCTTACGAAAA
AAGAGCTCGCTTTATTAGCAAAAAGACATCGCAAATTGCTCAACAACCTG
GAAGGCGTTCGTCATATGAACTCTCTCCCAGGGCTTCTGATTGTAATTGA
CCCAGGCTATGAGCGCATTGCTGTTGCGGAAGCTGGGAAACTTGGCATTC
CTGTCATGGCTTTAGTGGATACAAACTGCGATCCAACACCTATTAATCAT
GTTATCCCTTGTAACGATGATTCCATGAAAAGTATCCGTCTGATTGTCAA
TGTGCTTAAAGATGCTGTTATTGATGCGAAGAAACGTTTAGGCGTCGAAA
TTTTATCTCCGGTGCGTCCTGCAGAAAGACCTGCGGAAGAAGCTGTTGAA
GAGCTTCCTCTTCCAACAGGAGAAGCTCAAGATGAAGCTTCTTCTAAAGA
GGGGGTTTTACTCTGGGCAGATATTGACAATTGCGAGGCATTGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy