Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-3 tRNA-Lys-1 tRNA-Glu-1 IGR560 IGR558 IGR561 IGR559 IGR562 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 yscC,sctC, - CT674 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 yscC,sctC, - CT674 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 CT676 CT676 yscC,sctC, - CT674 pbpB, - CT682
* Calculated from Protein Sequence

Gene ID: CT679

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tsf  

Definition:
elongation factor TS (EF-TS)

Gene Start:
777664

Gene Stop:
776819

Gene Length:
846

Molecular Weight*:
30868

pI*:
5.23

Net Charge*:
-7.62

EC:
 

Functional Class:
translation; translation factors  

Pathway: pathway table

Primary Evidence:
Zhang Y, Tao J, Zhou M, Meng Q, Zhang L, Shen L, Klein R, Miller DL 1997. Elongation factor Ts of Chlamydia trachomatis: structure of the gene and properties of the protein. Arch Biochem Biophys 344(1):43-52. Medline: 9244380.

Comment:
This protein binds to the EF-TU-GDP complex and apparently induces the exchange of GDP to GTP. See the comment to CT677.

From Prosite PDOC00867:

In prokaryotes elongation factor Ts (EF-Ts) is a component of the elongation cycle of protein biosynthesis. It associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP, it remains bound to the aminoacyl-tRNA. EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.

EF-Ts is also a component of the chloroplast protein biosynthetic machinery and is encoded in the genome of some algal chloroplast. It is also present in mitochondria.

See GenBank accession U60196.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to elongation factor EF-Ts proteins, e.g., 38% similarity to EFTS_SPIPL , 35% similarity to EFTS_HAEIN.
CT679 is identical to P71146 EFTS_CHLTR, a previously published trachomatis elongation factor Ts protein. CT679 is similar to
TP0605 in T.pallidum and to MG433 in M.genitalium, both predicted
elongation factor TS sequences.

CT679 is orthologously related to CPn0697: residues 1-282 of CT679
are 68% similar to residues 1-282 of CPn0697, a predicted elongation factor TS (EF-TS) from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0264
COG name: Translation elongation factor Ts
Functional Class:  J
The phylogenetic pattern of COG0264 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 7-27, 42-60, 72-85, 132-145 are significantly matched to BL01126A,B,C,D, concerned with elongation factor Ts proteins, e.g. EFTS_CHLTR.

ProDom Summary:  Protein Domain Search
Residues 9 to 281 are 86% similar to a TS EF_TS domain as seen in EFTS_CHLTR, EFTS_ANTSP and EFTS_PORPU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 4 to 44 (E-value = 1.2e-07) place CT679 in the UBA family which is described as UBA/TS-N domain (PF00627)
Residues 57 to 282 (E-value = 1.3e-104) place CT679 in the EF_TS family which is described as Elongation factor TS (PF00889)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
129

PDB Hit:
gi|1942722|pdb|1EFU|B Chain B, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Elongation Factor, Complex (Two Elongation Factors) Mol_id: 1; Molecule: Elongation Factor Tu; Chain: A, C; Synonym: Elongation Factor For Transfer, Heat Unstable.

Gene Protein Sequence:
MSDFSMETLKNLRQQTGVGLTKCKEALEHAKGNLEDAVVYLRKLGLASAG
KKEHRETKEGVIAARVDERGAALVEVNVETDFVANNNVFRAFVTSLLSDL
LDHELSDVDALALVMSSQEPSLSVEELKAVTMQTVGENIRISRAFYTPVN
SGQSVGIYSHGNGKAVAIAFLSGSENQEALAKDIAMHIVASQPQFLSKES
VPQEVLEREREVFSSQVAGKPQEVVEKITQGKFRAFFQEACLLEQAFIKD
PEVTIQGLIDRAAKASGEPLKVEHFVFWKMGA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGACTTCTCCATGGAAACATTGAAAAATTTAAGACAGCAGACAGG
TGTAGGCCTGACTAAATGTAAAGAAGCTCTTGAGCACGCCAAGGGCAATT
TAGAGGATGCGGTTGTTTATTTACGTAAGCTCGGGCTTGCCTCTGCAGGC
AAAAAAGAGCACCGAGAAACAAAAGAGGGCGTGATTGCTGCACGAGTTGA
TGAACGTGGTGCAGCGCTTGTTGAAGTTAACGTTGAAACCGATTTTGTTG
CTAACAACAACGTATTTCGAGCATTCGTTACGAGTTTATTGTCCGATCTT
CTTGACCACGAGCTTAGCGATGTTGATGCTTTGGCTCTCGTAATGTCCTC
TCAAGAGCCTTCCTTATCTGTGGAAGAGCTTAAAGCTGTCACGATGCAAA
CGGTTGGAGAGAATATCCGCATTAGCCGAGCTTTCTACACGCCTGTTAAC
TCTGGTCAAAGTGTAGGGATTTATTCTCATGGAAATGGAAAAGCTGTGGC
TATAGCTTTCCTTTCTGGGTCTGAGAATCAAGAGGCTTTGGCTAAAGACA
TTGCTATGCATATTGTCGCAAGTCAGCCGCAGTTCTTAAGTAAAGAAAGC
GTTCCTCAAGAAGTTCTAGAAAGAGAACGAGAAGTATTTTCTTCCCAAGT
GGCTGGGAAACCCCAAGAAGTAGTTGAGAAAATTACTCAAGGGAAATTTA
GGGCCTTTTTCCAAGAGGCTTGTTTGTTAGAACAAGCCTTTATTAAAGAC
CCTGAAGTCACAATTCAAGGTCTGATTGATAGAGCTGCAAAAGCTAGTGG
CGAGCCACTCAAAGTTGAGCACTTTGTCTTCTGGAAAATGGGCGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy