Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-3 tRNA-Lys-1 tRNA-Glu-1 IGR560 IGR558 IGR561 IGR559 IGR562 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 yscC,sctC, - CT674 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 yscC,sctC, - CT674 pbpB, - CT682 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 CT676 CT676 yscC,sctC, - CT674 pbpB, - CT682
* Calculated from Protein Sequence

Gene ID: CT678

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrH  

Definition:
uridylate kinase

Gene Start:
776803

Gene Stop:
776069

Gene Length:
735

Molecular Weight*:
26221

pI*:
5.19

Net Charge*:
-4.51

EC:
2.7.4.-  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidines  

Pathway: pathway table

Comment:
This protein appears to have both UMP kinase and aspartokinase potential.
See the comment to CT677.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to uridylate kinase proteins, e.g., 40% similarity to uridylate kinase in B. subtilis (Z99112), 39% similarity to PYRH_HAEIN.
CT678 is identical to (P71147)PYRH_CHLTR, a previously published trachomatis uridylate kinase protein. CT678 is similar to MG434, a
predicted mukB suppressor protein in M.genitalium. No similarity to
T.pallidum.

CT678 is orthologously related to CPn0698: residues 2-238 are 73%
similar to CPn0698.


COGS Summary:  COGS Search
BeTs to 16 clades of COG0528
COG name: Uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0528 is amtk-qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 7-18 are matched to block BL00205F, concerned with Transferrins proteins, e.g. TRF_BLADI.

ProDom Summary:  Protein Domain Search
Residues 15-127 and 144-187 are 94% and 95% similar to uridylate kinase and aspartokinase domains respectively as seen in PYRH_CHLTR.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 7 to 219 (E-value = 6.3e-51) place CT678 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19
non-globular  
20  
115

PDB Hit:
None.

Gene Protein Sequence:
MMKKRVKRVLFKISGEALSDGDSSNRISEERLSRLIAELKVVRNADVEVA
LVIGGGNILRGLSQSQSLQINRVSADQMGMLATLINGMALADALKTEDVP
NLLTSTLSCPQLAELYNPQKASDALSQGKVVICTMGAGAPYLTTDTGAAL
RACELKVDVLLKATMHVDGVYDQDPRECADAVRYDHISYRDFLSQGLGAI
DPAAISLCMEAGIPIKMFSFARHSLEEAVFNTVGTVISSTEGGQL

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAAAAACGAGTGAAACGAGTTTTATTCAAGATCTCTGGAGAGGC
TCTTTCTGATGGAGATTCTAGCAATAGAATTAGTGAAGAAAGACTCTCCC
GATTAATTGCGGAATTAAAAGTCGTCCGCAATGCAGATGTTGAGGTTGCG
CTGGTAATCGGTGGGGGCAATATCCTCCGCGGCCTCTCACAAAGCCAGAG
CCTGCAGATTAATCGGGTTTCGGCTGATCAGATGGGAATGTTAGCGACAT
TGATTAATGGAATGGCGCTAGCGGATGCTTTGAAGACTGAGGATGTGCCC
AATTTATTGACATCGACTTTGTCATGCCCACAGTTAGCAGAGTTATACAA
TCCGCAAAAAGCATCTGACGCCCTAAGCCAGGGTAAAGTTGTGATATGCA
CCATGGGAGCAGGAGCTCCTTATCTAACAACGGACACAGGTGCAGCTTTG
CGAGCCTGTGAATTAAAGGTCGATGTTTTACTAAAAGCGACTATGCACGT
GGATGGGGTGTATGACCAAGATCCTCGTGAATGCGCTGATGCAGTAAGGT
ACGATCATATTTCTTACAGAGACTTTCTCTCCCAAGGATTGGGAGCGATC
GATCCGGCAGCCATATCTTTGTGTATGGAAGCAGGAATCCCCATAAAGAT
GTTTAGCTTTGCTAGACATTCTTTAGAGGAGGCAGTCTTTAATACTGTTG
GTACAGTGATATCTTCTACGGAAGGAGGACAATTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy