Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-3 tRNA-Lys-1 tRNA-Glu-1 IGR560 IGR558 IGR561 IGR559 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 pkn5, - CT673 yscC,sctC, - CT674 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 pkn5, - CT673 yscC,sctC, - CT674 rrf, - CT677 pyrH, - CT678 rs2, - CT680 tsf, - CT679 karG, - CT675 omp1,ompA, - CT681 CT676 CT676 pkn5, - CT673 yscC,sctC, - CT674
* Calculated from Protein Sequence

Gene ID: CT675

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
karG  

Definition:
arginine kinase

Gene Start:
774648

Gene Stop:
773581

Gene Length:
1068

Molecular Weight*:
40230

pI*:
6.51

Net Charge*:
-2.95

EC:
2.7.3.3  

Functional Class:
uncategorized  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism

Comment:
In eukaryotes, a cardiac and skeletal muscle enzyme. Rarely encountered in bacteria.
The intergenic spacing between CT674 and CT675 is 318 bp with tail to tail orientation.
The intergenic spacing between CT676 and CT677 is 373 bp.
CT675 overlaps with CT676 (6bp).
This translationally coupled suggest the function of the hypothetical protein of CT676 might be related to the function of CT675.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to arginine kinase proteins, e.g., 19% similarity to arginine kinase of Anthopleura japonicus (AB008014), 21% similarity to KARG_PENJP
No similarities to T.pallidum or M.genitalium.

Some similarity with a putative 39 kD protein from Listeria monocytogenese (accession U40604) and a 41.1 kD protein in the LysS-MecB intergenic region of Bacillus subtilis (YAC1_BACSU; accession P37570).

CT675 is orthologously related to CPn0701: residues 2-346 of CT675 are 51%
similar to residues 3-347 of CPn0701, a predicted arginine kinase from C. pneumoniae.


COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 19-52, 2-35, 91-137, 151-180, 199-247 are significantly matched to BL00112B,D,E,F, concerned with ATP:guanido phosphotransferases proteins, e.g. KARG_CAEEL and SMC7_SCHMA.


ProDom Summary:  Protein Domain Search
Residues 32 to 236 are 24% similar to an arginine kinase domain as seen in KARG_LIMPO.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 12 to 261 (E-value = 9.7e-05) place CT675 in the ATP-gua_Ptrans family which is described as ATP:guanido phosphotransferase, C-terminal catalytic domain (PF00217)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
171  
278

PDB Hit:
None.

Gene Protein Sequence:
MLPNHILTAIATIKHSLRTETPRPICTLSLSRNLSVSKFVPCLSKENKRD
VLETIAKQFSAIEGEEFFVLPLKDLPIWQRECLLEHYLFPYHLGSYLEGE
ALIVNQAGTLLAGINLRDHLVIHGVDFVWQPEVLLQKLIDLDIRLQQSLS
FAFSSDFGFLTADPLRCGTALIARAFVHVPALKYGDALSELLVPYQREFA
SSSLLPLSQESLGDILCLSNICSLGLSEEQILSSLRLVVSKILSAEREAR
NQLVKENPTEIKNRILRSVGMLTHSCCLDLQEALDATSWIQLGMSMQWIE
DSEKHPLWNPLFWDLRRGHLALYNQDTANRSIEKEVIAQIRAKATKPQAE
RLIIRI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCCCTAATCATATTCTTACTGCTATCGCAACGATCAAACATTCTTT
GAGAACGGAGACGCCGCGCCCTATTTGCACGCTCTCTTTATCTAGAAATC
TTTCTGTTTCCAAATTCGTTCCCTGTCTTTCTAAGGAAAACAAACGTGAT
GTGTTAGAGACTATAGCCAAACAGTTTTCAGCTATCGAAGGTGAGGAATT
CTTTGTTTTACCCCTGAAAGATTTGCCTATCTGGCAACGAGAATGTTTAT
TAGAACATTATTTGTTTCCATATCATCTTGGGAGTTATTTGGAAGGTGAG
GCTCTGATTGTAAATCAGGCAGGCACGTTGTTAGCCGGCATTAATCTACG
TGACCACTTAGTGATCCATGGCGTAGATTTTGTATGGCAGCCGGAAGTAT
TACTCCAGAAGCTGATCGATTTAGATATACGTTTACAACAGTCTCTTTCT
TTTGCTTTTTCTTCGGATTTTGGATTTTTAACCGCAGATCCCCTACGTTG
TGGAACGGCGCTGATAGCGCGAGCCTTTGTTCATGTTCCGGCTCTTAAGT
ATGGAGACGCGTTGTCTGAGCTTTTAGTTCCTTATCAACGCGAGTTCGCT
AGCTCTTCTTTACTTCCGTTATCACAGGAATCATTAGGAGATATCTTGTG
CTTGTCCAATATTTGTTCATTAGGGCTATCAGAAGAGCAGATCCTATCTT
CATTAAGACTAGTAGTGTCAAAAATTTTATCTGCTGAGAGAGAGGCTAGA
AACCAGCTTGTGAAAGAAAATCCTACAGAAATAAAAAATCGCATTTTACG
TTCTGTGGGGATGTTGACACATTCTTGTTGTTTAGATTTGCAAGAGGCAT
TGGATGCCACTAGCTGGATACAATTAGGAATGAGTATGCAGTGGATTGAA
GATAGCGAAAAACACCCTTTATGGAATCCTTTATTCTGGGATCTACGCAG
AGGTCACCTTGCTCTGTATAACCAAGATACTGCGAATAGAAGCATTGAAA
AGGAAGTGATCGCCCAGATCCGGGCCAAGGCAACAAAACCCCAGGCAGAG
CGACTGATTATTCGAATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy