Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-3 IGR553 IGR555 IGR556 IGR554 IGR557 IGR558 karG, - CT675 CT670 CT668 CT671 CT672 sctN,yscN, - CT669 pkn5, - CT673 yscC,sctC, - CT674 karG, - CT675 CT670 CT668 CT671 CT672 sctN,yscN, - CT669 pkn5, - CT673 yscC,sctC, - CT674 karG, - CT675 CT676 CT676 CT670 CT668 CT671 CT672 sctN,yscN, - CT669 pkn5, - CT673 yscC,sctC, - CT674
* Calculated from Protein Sequence

Gene ID: CT673

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pkn5  

Definition:
possible serine/threonine kinase

Gene Start:
769031

Gene Stop:
770500

Gene Length:
1470

Molecular Weight*:
55916

pI*:
6.60

Net Charge*:
-3.78

EC:
2.7.-.-  

Functional Class:
translation; protein modification  

Pathway: pathway table

Comment:
See CT301 and CT145. This gene tentatively designated pkn5.
The intergenic spacing between CT672 and CT673 is 137 bp.
The intergenic spacing between CT674 and CT675 is 318 bp with tail to tail orientation.
CT673 and CT674 appear to be translationally coupled (the stop codon of CT673 overlaps with the start codon of CT674, GTGA).
See CPn0703.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to S/T kinases, e.g., residues
3-287 are 25% similar to the Arabidopsis enzyme (X94757). CT673 is similar
to MG109, a predicted serine/threonine kinase in M.genitalium. No
similarity to T.pallidum.
CT673 is homologously related to CPn0703: residues 15-490 are 42% similar to CPn0703.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class:  T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 3


Blocks Summary:  Blocks Search
Residues 127-157, 185-200 and 420-435 have matches to blocks
BL00107A,B, which encompass protein kinase sequences, e.g.,
ST20_YEAST and PKNB_MYCLE.

ProDom Summary:  Protein Domain Search
Residues 66-202 are 25% similar to a protein kinase domain
observed in PAK3_RABIT. Residues 82-159 and 120-159 also correspond to
defined protein kinase domains, e.g., KCIG_BOVIN and M38B_HUMAN.

Paralogs:  Local Blast Search
CT673 is paralogously related to CT301, also thought to be
an S/T kinase sequence: residues 20-250 are 23% similar to this
protein. CT673 is weakly related to CT145.

Pfam Summary:  Pfam Search
Residues 19 to 247 (E-value = 2.9e-27) place CT673 in the Pkinase family which is described as Protein kinase domain (PF00069)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
77  
248

PDB Hit:
gi|3114436|pdb|1A06| Calmodulin-Dependent Protein Kinase From Rat Kinase, Signal Transduction, CalciumCALMODULIN Mol_id: 1; Molecule: CalciumCALMODULIN-Dependent Protein Kinase; Chain: Null; Ec: 2.7.1.123; Engineered: Yes

Gene Protein Sequence:
MLRSGVSFSSSKTNYLLTRELSRKVGLTVYQGVDEHSSRPVVIKTLVSPG
IHDRRFLRAFEEEARIMQLVTHPAFVRLEDRGECEQGRYLVSEYILGSSL
RDSILSSQISLDKAISIVLQVAQAITTLHRHGVLHLDIKPENIVLSQSGE
IKLIDYGLSAWQFNHWGSPAYMSPEQSRQEPPSPASDVYSLALLAYELIM
GQLALGKVYVSLLPSKISKILIQALQPSPAARFSSMQEFAEALQDYLLHD
VHEDYRKKDHVVAQIEQWHNQRAWLSPEKLSAPEEICVHIYSQKEPCYLH
NIYYDMLTSGNVAEFWFCYAPGNCSFALSMMKQFLNQREEKAKDIQTVIK
SMDTLCKTMHIPICEEGISCCCFIFFLEELMCFSCGKTDFSLKKQTGGGQ
RFQAESQGIGEETPLEIHEQSFLWEPGDELIVHTPKARDLVYLYCPSFLK
LQDRGQIDIFCQTDNLQKGIRQKYDRSLYPSTLISLKRVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAGATCGGGTGTATCCTTCTCCTCCTCTAAGACGAACTATCTCCT
AACACGGGAGCTCAGTCGTAAGGTAGGGTTGACTGTCTATCAAGGTGTGG
ATGAGCACTCTTCTCGTCCTGTTGTTATTAAAACATTGGTATCGCCAGGA
ATTCATGATCGACGTTTTCTTCGTGCTTTCGAAGAAGAAGCAAGGATTAT
GCAGCTAGTAACGCACCCAGCGTTTGTTCGCTTGGAGGATAGAGGAGAGT
GTGAGCAGGGACGCTACTTGGTTTCGGAATACATTTTAGGGAGTTCTCTG
CGAGATAGTATTCTTTCATCGCAAATCTCTTTGGATAAAGCGATTTCTAT
TGTCTTGCAAGTAGCGCAAGCTATCACGACTCTGCATCGGCATGGGGTTT
TACATCTCGATATCAAACCAGAAAATATCGTGCTCTCGCAATCAGGCGAG
ATCAAGCTCATTGACTATGGGCTTTCCGCTTGGCAATTCAATCATTGGGG
ATCTCCAGCATATATGAGTCCTGAGCAGAGCAGACAGGAACCGCCCTCTC
CGGCATCCGATGTGTATTCCCTAGCTTTGTTGGCCTATGAACTGATCATG
GGGCAGCTTGCATTAGGAAAGGTATATGTATCGTTACTGCCTTCTAAGAT
CAGCAAAATTTTAATACAGGCATTACAGCCATCACCGGCAGCACGCTTTT
CATCCATGCAAGAGTTTGCAGAAGCTTTACAAGATTACTTATTGCACGAT
GTACATGAGGATTATCGTAAGAAAGACCATGTTGTTGCACAGATAGAACA
GTGGCACAATCAGAGAGCGTGGCTATCTCCAGAAAAGTTATCTGCTCCGG
AAGAGATCTGTGTTCATATTTACTCACAAAAAGAGCCCTGTTATTTACAT
AATATTTACTATGATATGCTTACATCTGGAAACGTAGCAGAATTTTGGTT
CTGCTACGCTCCAGGAAACTGTAGTTTTGCGCTTAGCATGATGAAACAGT
TTCTTAATCAACGAGAGGAGAAAGCAAAAGATATTCAAACAGTAATCAAA
AGTATGGATACTCTGTGCAAAACCATGCATATCCCTATTTGTGAAGAAGG
GATTTCTTGTTGCTGTTTTATATTTTTCCTAGAAGAACTCATGTGCTTTT
CTTGTGGGAAAACTGATTTCTCGTTAAAAAAGCAAACAGGGGGGGGGCAA
CGATTTCAAGCGGAATCGCAAGGAATTGGGGAGGAAACTCCCCTAGAGAT
CCACGAACAGTCCTTTTTGTGGGAGCCTGGAGATGAGCTTATCGTACACA
CCCCAAAGGCTAGAGATTTGGTATATTTATATTGCCCTTCTTTCCTGAAG
TTGCAAGATAGAGGGCAAATAGATATATTCTGCCAAACAGATAACCTGCA
GAAGGGAATAAGGCAGAAGTATGACAGAAGTCTTTATCCCTCAACACTTA
TCAGCTTAAAAAGAGTCCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy