Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR548 IGR545 IGR551 IGR550 IGR549 IGR543 IGR544 IGR546 IGR547 gyrA, - CT660 gyrB, - CT661 CT659 CT666 CT665 CT663 CT667 rluD,sfhB, - CT658 hemA, - CT662 CT664 gyrA, - CT660 gyrB, - CT661 CT659 CT666 CT665 CT663 CT667 rluD,sfhB, - CT658 hemA, - CT662 CT664 gyrA, - CT660 gyrB, - CT661 CT663 CT667 rluD,sfhB, - CT658 hemA, - CT662 CT664 CT659 CT665 CT666
* Calculated from Protein Sequence

Gene ID: CT662

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemA  

Definition:
glutamyl-tRNA reductase

Gene Start:
758667

Gene Stop:
759710

Gene Length:
1044

Molecular Weight*:
40348

pI*:
7.49

Net Charge*:
2.34

EC:
1.2.1.-  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Comment:
This protein is thought to play a role in first step in porphyrin biosynthesis by the C5 pathway.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glutamyl-tRNA reductase proteins, e.g., 22% similarity to HMA2_CUCSA, 21% similarity to HMA1_CUCSA, 21% similarity to HMA1_HORVU.
No similarities to T.pallidum and M.genitalium.

CT662 is orthologous to CPn0714: residues 28-320 are 45% similar to CPn0714.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0373
COG name: Glutamyl-tRNA reductase
Functional Class:  H
The phylogenetic pattern of COG0373 is amt--q-cebr-uj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 28-48, 70-80, 113-136, are significantly matched to BL00747A, B, C, D, E blocks, concerned with glutamyl-tRNA reductase proteins, e.g. HEM1_ANASP and HEM1_COXBU. Residues 329-338 are significantly matched to BL01299A blocks, concerned with ephrins proteins, e.g. EFA3_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 69 to 241 are 30% similar to glutamyl-tRNA reductase GLUTR precursor probable NFE2 protein domain as seen in HEM1_MYCTU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 31 to 171 (E-value = 2.5e-54) place CT662 in the GlutR_N family which is described as Glutamyl-tRNAGlu reductase, N-terminal domain (PF05201)

PDB Hit:
none

Gene Protein Sequence:
MMRGSLRSKEETVMVREGEERIGNRVSLGVIGVSYRETTLQQREQVLHIL
QQAQGSFRPEVFQEERDYVLLATCHRVELYSVAPAELFDSLAQEIELLGV
SPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSF
ALHFLFQKALKEGKVFRAKGGAPYAEITIPILVDQELRRRQIDKKASLLF
IGYSEINRSVAYHLQRQGFSCITFCSRQQLPTLSMRQVVREELCFQDPYR
VVFLGSSELQYALPHSLWESIWDIPDRIVFDFAVPRALPSHTVFPHRYVD
MDQISDWLREHRKEVNSAHLHSLREVAYRYWNSLNQRLERRDCVGANA

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAGAGGGAGCTTAAGGAGTAAAGAAGAAACCGTGATGGTTAGGGA
AGGGGAAGAACGTATAGGTAATAGAGTTTCGTTGGGCGTTATTGGCGTGA
GTTATCGAGAGACTACTTTGCAGCAACGAGAGCAAGTTCTTCACATTTTA
CAACAAGCACAGGGGTCTTTTCGTCCTGAAGTCTTTCAAGAAGAGAGGGA
CTATGTTTTATTGGCTACGTGCCATCGCGTCGAGTTGTATAGCGTCGCGC
CAGCCGAGCTATTTGATTCACTGGCACAGGAAATAGAGCTCTTAGGTGTC
TCGCCTTATTTTTATCGAAATCAAGATTGCTTTGCACATTTATTTTGTGT
AGCAGGCGGGTTAGATAGCTTAGTTCTTGGAGAGACGGAGATTCAAGGAC
AAGTGAAACGTGCCTATTTACAAGCTGCTAGAGAGCAAAAGCTTTCTTTT
GCTCTCCATTTTCTCTTTCAAAAAGCCCTTAAGGAAGGGAAAGTATTTCG
AGCGAAAGGAGGCGCGCCTTATGCAGAAATCACTATCCCTATTCTCGTGG
ATCAGGAGTTACGAAGACGTCAAATAGATAAGAAGGCCTCTTTGTTATTT
ATAGGCTATTCTGAGATCAATCGTTCTGTAGCTTATCATTTGCAAAGGCA
AGGATTTTCTTGTATCACCTTTTGTTCTCGTCAGCAGCTGCCGACGTTAT
CTATGCGTCAGGTAGTAAGAGAGGAGCTATGTTTTCAAGATCCTTATCGC
GTCGTGTTTTTAGGTTCTTCAGAATTGCAGTATGCTCTGCCACATTCCCT
TTGGGAAAGTATCTGGGATATCCCCGATCGGATTGTTTTTGATTTTGCTG
TTCCTCGTGCTCTGCCTTCGCATACGGTATTCCCTCACCGGTACGTGGAT
ATGGACCAAATCAGTGATTGGTTAAGAGAGCATCGAAAGGAAGTGAACTC
AGCACATCTCCACAGCTTGAGAGAGGTTGCGTACCGTTATTGGAACTCTC
TAAATCAAAGATTAGAACGGCGTGACTGTGTAGGAGCGAACGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy