Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR541 IGR548 IGR545 IGR542 IGR543 IGR544 IGR546 IGR540 IGR547 gyrA, - CT660 gyrB, - CT661 CT659 CT656 CT657 CT663 rluD,sfhB, - CT658 hemA, - CT662 CT664 gyrA, - CT660 gyrB, - CT661 CT659 CT656 CT657 CT663 rluD,sfhB, - CT658 hemA, - CT662 CT664 gyrA, - CT660 gyrB, - CT661 CT659 CT657 CT663 rluD,sfhB, - CT658 hemA, - CT662 CT664 CT656
* Calculated from Protein Sequence

Gene ID: CT661

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase subunit B (topoisomerase)

Gene Start:
758326

Gene Stop:
756512

Gene Length:
1815

Molecular Weight*:
68251

pI*:
8.99

Net Charge*:
9.44

EC:
5.99.1.3  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
Just as CT660 is paralogously related to CT189, CT661 is paralogously related to CT190.

From Prosite PDOC00160:

DNA topoisomerase I (EC 5.99.1.2) is one of the two types of enzyme that catalyze the interconversion of topological DNA isomers. Type II topoisomerases are ATP-dependent and act by passing a DNA segment through a transient double-strand break. Topoisomerase II is found in phages, archaebacteria, prokaryotes, eukaryotes, and in African Swine Fever virus (ASF). In bacteriophage T4 topoisomerase II consists of three subunits (the product of genes 39, 52 and 60). In prokaryotes and in archaebacteria the enzyme, known as DNA gyrase, consists of two subunits (genes gyrA and gyrB). In some bacteria, a second type II topoisomerase has been identified; it is known as topoisomerase IV and is required for chromosome segregation, it also consists of two subunits (genes parC and parE). In eukaryotes, type II topoisomerase is a homodimer.


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to DNA gyrase subunit B sequences
(topoisomerases), e.g., 30% similarity to the B. subtilis enzyme,
29% similarity to GYRB_STAAU, etc. CT661 is similar to TP1006,
a predicted gyrase B sequence from T.pallidum and to MG003, a predicted
gyrase B of M.genitalium.

CT661 is orthologously related to CPn0715:residues
6-604 are 71% similar to residues 3-601 of CPn0715.



COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Significant matches to blocks BL00177A,C,D,E,F,G which encompass
topoisomerases. Residues 18-32, 121-164, 251-264, 303-314,
403-446, 463-497, and 543-563 of CT661 match these blocks.

ProDom Summary:  Protein Domain Search
Closest domains observed in GYRB_HELPY: residues 240-454 show
34% similarity to this protein. Other similarities are
over residues 51-175 (34%) to GYRB_MYCBA and over residues
465-526 (43%) to GYRB_MYCBA.

Paralogs:  Local Blast Search
CT661 is paralogously related to CT190, also a DNA gyrase subunit B: residues 7-597 are 31% similar to CT190.

Pfam Summary:  Pfam Search
Residues 37 to 170 (E-value = 1.5e-12) place CT661 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 210 to 365 (E-value = 2.6e-25) place CT661 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
342  
376
non-globular  
502  
605

PDB Hit:
gi|3212436|pdb|1AJ6| Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution Topoisomerase, Gyrase, Novobiocin, Antibiotic, Resistant Mutant Mol_id: 1; Molecule: Gyrase;

Gene Protein Sequence:
MRKKTAYSESSIISLASLDHIRLRAGMYIGRLGDGSQAEDGIYTLFKEVV
DNAIDEFVMGYGHTIHITGDAHELSIRDEGRGIPLGKVIDCVSKINTGAK
YTQDVFHFSVGLNGVGLKAVNALSQHFSVRSVRNKKFLKASFSKGILLHT
EQGATQDPDGTEVVFSPDHELFENFSFQVEFLKKKIRQYTYLHPGLTIIY
NGERIVSTRGLLDLFEEEVQTPLLYSPITFQHSDLAFLFSHTETSSEQYF
SFVNGQETTDGGTHLVAFKEGIVKGVNEFFGKNFSSQDIREGLAGCIAIK
IASPIFESQTKNKLGNTNIRAELAKRVKEAVLSSLKKNPSSAERIQEKIK
LNEKTRKNAQFLKQELKDKQKKLHYKIPKLRDCKFHLTDNSLYGKNSSIF
ITEGESASASILASRNPLTQAVFSLRGKPMNVFSSKEETIYKNDELFYLT
TALGLHKDSLQNLRYNQVILATDADVDGMHIRNLMITFFLKTFLPLVASN
HLFILETPLFKVRHKDATFYCYSEEEKLSTIEHIGKKESSLEITRFKGLG
EISPKEFKSFIGADMRLTPVSLPDTETLDTLLQFYMGKNTKERKLFIIEN
LVTNL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAAAAAAAACTGCGTATTCAGAATCTTCTATCATTTCTTTAGCTTC
CTTGGATCATATCCGCCTACGCGCGGGAATGTATATTGGAAGATTAGGCG
ACGGATCTCAAGCTGAAGACGGCATTTACACGTTATTTAAAGAAGTAGTC
GATAATGCTATTGATGAATTTGTCATGGGATATGGACACACCATCCACAT
AACAGGAGACGCACACGAACTGTCTATTCGTGATGAAGGCCGCGGCATTC
CCTTGGGGAAGGTGATTGATTGTGTTTCTAAAATCAATACTGGCGCGAAA
TACACTCAGGATGTTTTCCATTTTTCTGTTGGATTAAATGGCGTGGGACT
GAAAGCCGTTAATGCCTTATCGCAACATTTCTCTGTACGTTCTGTGCGGA
ACAAAAAATTCCTCAAAGCTTCTTTCTCCAAAGGCATTCTCTTACACACA
GAACAGGGCGCTACCCAAGATCCCGACGGTACAGAAGTCGTTTTCTCTCC
CGATCATGAACTATTCGAGAATTTTTCTTTCCAAGTGGAGTTTCTAAAAA
AGAAAATCCGTCAATACACCTATCTCCATCCCGGACTGACAATTATTTAT
AACGGAGAACGTATTGTTTCCACTCGTGGTCTTCTTGATCTTTTTGAAGA
AGAAGTGCAAACCCCTCTTCTGTATTCCCCTATTACGTTTCAACACTCCG
ATCTCGCATTTCTTTTCTCCCATACAGAAACGTCTTCCGAACAATATTTT
TCCTTTGTAAATGGCCAAGAAACAACTGATGGCGGAACCCATCTCGTTGC
CTTTAAAGAGGGTATAGTCAAGGGCGTTAATGAGTTTTTTGGAAAAAACT
TTTCCTCTCAAGATATTCGTGAGGGACTTGCTGGCTGTATCGCCATTAAA
ATTGCTTCTCCTATTTTTGAATCCCAAACCAAAAATAAACTAGGGAATAC
GAATATCCGCGCAGAGTTAGCCAAACGCGTAAAAGAAGCTGTGCTCTCTT
CTTTGAAAAAGAATCCTTCCAGCGCGGAACGGATCCAAGAGAAAATCAAA
CTCAACGAAAAAACTCGGAAGAATGCGCAATTTCTCAAGCAAGAGCTCAA
AGATAAACAAAAAAAACTCCACTATAAAATCCCTAAACTTCGGGATTGTA
AATTTCATCTCACAGACAATTCTCTGTATGGTAAAAATTCCTCTATTTTC
ATTACTGAAGGAGAATCGGCTTCCGCTTCGATTCTAGCTTCGCGAAATCC
GCTCACACAAGCAGTGTTCTCTTTGAGAGGGAAACCTATGAACGTCTTTT
CCTCCAAAGAAGAAACCATCTATAAAAATGACGAACTTTTTTACCTTACT
ACAGCCCTCGGCCTGCACAAAGACTCTCTACAAAATCTTCGATACAACCA
GGTGATCTTAGCAACAGATGCGGATGTTGATGGTATGCATATTCGTAATC
TTATGATTACTTTCTTCCTAAAAACCTTTCTTCCTCTTGTTGCAAGCAAC
CACCTATTTATCCTAGAAACCCCTCTTTTTAAAGTACGCCACAAAGATGC
CACTTTCTATTGCTACTCAGAAGAAGAAAAACTCTCGACCATAGAACACA
TCGGTAAAAAAGAATCGTCTCTTGAAATTACTCGTTTCAAAGGCTTAGGA
GAAATTTCTCCTAAAGAATTCAAATCTTTTATCGGCGCAGACATGCGCTT
AACTCCAGTTTCTCTTCCTGATACAGAAACCCTCGACACACTTTTACAAT
TCTACATGGGAAAAAACACAAAAGAGAGAAAACTATTTATTATTGAGAAT
CTTGTTACCAACCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy