Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR541 IGR539 IGR545 IGR542 IGR543 IGR544 IGR546 IGR540 CT654 yhbG, - CT653 kdsA, - CT655 gyrA, - CT660 gyrB, - CT661 CT652.1 CT659 CT656 CT657 rluD,sfhB, - CT658 hemA, - CT662 recD, - CT652 CT654 yhbG, - CT653 kdsA, - CT655 gyrA, - CT660 gyrB, - CT661 CT652.1 CT659 CT656 CT657 rluD,sfhB, - CT658 hemA, - CT662 recD, - CT652 CT654 yhbG, - CT653 kdsA, - CT655 gyrA, - CT660 gyrB, - CT661 CT652.1 CT659 CT657 rluD,sfhB, - CT658 hemA, - CT662 recD, - CT652 CT656
* Calculated from Protein Sequence

Gene ID: CT658

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rluD  sfhB  

Definition:
ribosomal large subunit pseudouridine synthase D (pseudouridylate synthase) (uracil hydrolyase)

Gene Start:
753544

Gene Stop:
754545

Gene Length:
1002

Molecular Weight*:
37750

pI*:
7.47

Net Charge*:
2.49

EC:
4.2.1.70  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:
In E.coli, this protein is thought to belong to the YABO/YCEC/SFHB family (sfhB) and play a role as a suppressor of the temperature-sensitivity of the FTSH1(TS) mutation.

Blast Summary:  PSI-Blast Search
Numerous hits in Psi-BLAST to conserved hypothetical SfhB proteins, e.g., 37% similarity to YLYB_BACSU, 36% similarity to SFHB_ECOLI, 33% similarity to SFHB_HAEIN.
CT658 is similar to TP0339, a hypothetical in T.pallidum and to MG209,
a hypothetical in M.genitalium.

CT658 is orthologously related to CPn0719: residues 10-324 of CT658
are 66% similar to residues 4-314 of CPn0719, a predicted ribosomal
large subunit Pseudouridine synthases D (pseudouridylate synthase)
(uracil hydrolyase) from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class:  J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 90-110, 145-187, 108-150, 218-226, 243-267, 279-284 are significantly matched to BL01129A, B,C,D,E, concerned with Hypothetical yabO/yceC/sfhB family proteins, e.g. SFHB_BORBU and Y042_HAEIN.
Residues 15-55 are significantly matched to BL00632C, concerned with Ribosomal protein S4 proteins, e.g. RS4_HAEIN.

ProDom Summary:  Protein Domain Search
Residues 91 to 184 are 46% similar to a protein domain as seen in SFHB_BORBU. Residues 194 to 267 are 48% similar to a protein domain as seen in YMDA_CHLAU. Residues 234 to 296 are 32% similar to a protein domain as seen in Y370_MYCPN.

Paralogs:  Local Blast Search
CT658 is paralogously related to CT106, a Pseudouridine synthetase protein: residues 49-305 are 30% similar to CT106.

Pfam Summary:  Pfam Search
Residues 21 to 68 (E-value = 2.4e-12) place CT658 in the S4 family which is described as S4 domain (PF01479)
Residues 96 to 255 (E-value = 5.9e-71) place CT658 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
48  
110

PDB Hit:
none

Gene Protein Sequence:
MLEIPAPTAVFSFVIDEQLTGRLDKGLVSYNGAYSRAFYQQQIELGRVRV
NGRVYTRVSHPLSLGDVVEVELIEEEEPSSLIPEDIPLDKVYEDDMMLVI
NKPRDMVVHPAPGHTQGTVVHALLHEIGERLKQEFPEEPWRPGIVHRLDK
DTSGLLITVKTRRAKALYSELFATKQVKKLYVAICINAPSQERIHTRIAR
HPLKRKEMTVLSTHAEGGKEAITHCQVLATNGRLSVVALYPETGRTHQLR
VHMKHLGTPILGDPVYGIPSINFRYGLDKQQLHAYSLVFAHPESAERVKL
VTKLPDDMTSLIEKEFREGVSILDGSCDWFKITR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGGAAATCCCTGCTCCAACGGCTGTTTTTTCATTTGTAATTGATGA
ACAATTAACAGGACGCCTTGATAAGGGGCTGGTCTCGTATAATGGAGCGT
ATTCACGAGCTTTTTATCAGCAACAAATTGAGTTAGGGCGTGTCCGTGTT
AATGGGCGGGTGTATACGCGTGTTTCCCATCCGTTATCTCTAGGGGATGT
GGTAGAGGTGGAATTGATAGAAGAGGAAGAACCCTCTTCTTTAATCCCGG
AAGATATTCCTCTGGATAAGGTATATGAAGACGATATGATGTTGGTCATT
AATAAACCAAGAGATATGGTTGTCCATCCTGCTCCTGGGCATACGCAAGG
TACGGTGGTGCATGCTTTGCTGCATGAAATTGGGGAGCGTCTGAAACAAG
AGTTCCCCGAGGAGCCATGGCGCCCAGGGATTGTACATCGCTTAGATAAA
GATACTTCTGGTTTGTTGATTACAGTAAAAACTCGGCGAGCTAAGGCTCT
CTATAGTGAGCTCTTTGCTACCAAACAGGTAAAAAAGCTTTACGTAGCCA
TTTGCATTAATGCTCCGTCTCAGGAACGTATTCATACTCGGATAGCGCGT
CATCCTCTAAAAAGGAAGGAAATGACCGTGCTTTCTACACATGCCGAAGG
CGGTAAGGAAGCAATTACCCATTGCCAAGTTCTAGCTACGAATGGACGAT
TAAGTGTGGTTGCTCTATACCCAGAAACAGGCAGAACCCACCAGCTTCGT
GTACATATGAAGCACCTGGGCACACCGATTCTCGGAGATCCTGTTTACGG
GATCCCCTCTATAAATTTTCGTTATGGTCTTGACAAACAACAATTGCATG
CCTATAGCTTGGTTTTTGCTCATCCGGAGAGTGCGGAGCGAGTGAAGCTA
GTGACAAAGCTTCCAGACGATATGACTTCCTTAATAGAAAAGGAATTTAG
AGAAGGTGTCTCTATACTGGATGGTTCGTGTGATTGGTTTAAAATCACTA
GG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy