Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR534 IGR535 IGR532 IGR533 IGR536 IGR537 CT644 ygfA, - CT649 recA, - CT650 CT648 CT646 recD, - CT652 CT651 CT643 CT644 ygfA, - CT649 recA, - CT650 CT648 CT646 recD, - CT652 CT651 CT643 CT644 CT645 CT645 ygfA, - CT649 recA, - CT650 CT648 CT646 recD, - CT652 CT651 CT643 CT647 CT647
* Calculated from Protein Sequence

Gene ID: CT649

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ygfA  

Definition:
5-formyltetrahydrofolate cyclo-ligase (5,10-methenyltetrahydrofolate synthetase)

Gene Start:
744543

Gene Stop:
745076

Gene Length:
534

Molecular Weight*:
20731

pI*:
7.31

Net Charge*:
0.20

EC:
6.3.3.2  

Functional Class:
central intermediary metabolism; one carbon metabolism  
cofactor biosynthesis; folate  

Pathway: pathway table
One carbon pool by folate

Comment:
See the comment to CT646.

This enzyme is a ligase that adds ATP and 5-formyltetrahydrofolate to form
5,10-methenyltetrahydrofolate.

Blast Summary:  PSI-Blast Search
Numerous hits to prokaryotic hypothetical proteins and mammalian 5-formyltetrahydrofolate cyclo-ligases, e.g., 25% similarity to hypothetical protein of Aquifex aeolicus(AE000753), 24% similarity to YQGN_BACSU, 22% similarity to Y245_MYCPN and YGFA_ECOLI, 22% similarity to FTHC_HUMAN.
CT649 is similar to TP0694, a predicted 5,10-methenyltetrahydrofolate synthetase in
T.pallidum. It is also similar to MG245, a hypothetical in M.genitalium.
CT649 is identical to the previously published trachomatis hypothetical protein (Z32530).

CT649 is orthologously related to CPn0763: residues 7-177 are 37% similar to
CPn0763.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0212
COG name: 5-formyltetrahydrofolate cyclo-ligase
Functional Class:  H
The phylogenetic pattern of COG0212 is --t-yq-cebrhujgp-linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
None

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 8 to 178 (E-value = 3e-64) place CT649 in the 5-FTHF_cyc-lig family which is described as 5-formyltetrahydrofolate cyclo-ligase family (PF01812)

PDB Hit:
none

Gene Protein Sequence:
MKNIVEQKRCLRREGLAKREQLSVQRRDEAARELMHFVMQTIPQGFVLSY
IPFRSELDVRGINAWLAQENRLLLPKMQGMDIVPIALPFTKIESLYSPKD
LNRIEGEEIEAQQIAAALIPAIVFDQNKFRLGYGGGYYDRFLSKYPYIWT
IGVGFKEQLLAYLPREEYDVPLDQLYLT

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAACATTGTAGAGCAGAAACGTTGTTTGCGACGAGAAGGGTTAGC
GAAGCGCGAGCAGCTTTCTGTCCAGCGCAGAGATGAAGCAGCTCGTGAGC
TGATGCATTTTGTTATGCAGACAATTCCGCAAGGCTTTGTGTTATCCTAT
ATTCCTTTTCGCTCAGAGTTGGATGTTCGAGGGATCAATGCATGGTTAGC
GCAAGAGAACCGACTCCTCCTACCTAAAATGCAAGGGATGGATATCGTTC
CGATAGCTCTTCCTTTTACCAAGATAGAGAGTCTGTATTCTCCTAAAGAT
TTGAATCGGATAGAAGGAGAAGAGATCGAGGCACAACAGATTGCAGCGGC
CTTGATTCCTGCGATAGTCTTTGATCAGAACAAGTTTCGTTTAGGATATG
GCGGAGGCTACTATGATCGTTTTTTGTCTAAGTATCCGTATATTTGGACA
ATAGGCGTGGGATTTAAAGAGCAGCTGTTGGCGTATCTTCCAAGGGAAGA
GTATGATGTTCCCTTAGATCAGTTATATCTCACT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy