Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR534 IGR535 IGR532 IGR533 IGR536 IGR531 CT642 CT644 ygfA, - CT649 recA, - CT650 CT648 CT646 CT643 CT642 CT644 ygfA, - CT649 recA, - CT650 CT648 CT646 CT643 CT642 CT644 CT645 CT645 ygfA, - CT649 recA, - CT650 CT648 CT646 CT643 CT647 CT647
* Calculated from Protein Sequence

Gene ID: CT645

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)(probable membrane protein)

Gene Start:
741217

Gene Stop:
740924

Gene Length:
294

Molecular Weight*:
11819

pI*:
10.67

Net Charge*:
7.31

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
CT644 overlaps with CT645 (17bp) and they appear to be translationally coupled.

Blast Summary:  PSI-Blast Search
CT645 is orthologously related to CPn0767: residues 1-98 of CT645 are 65% similar to residues 1-98 of CPn0767, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. No similarity to M. genitalium or T. pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0762
COG name: Predicted integral membrane protein, YggT family
Functional Class:  S
The phylogenetic pattern of COG0762 is ------vCeb-huj--olin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 2 to 81 are 31% similar to a hypothetical domain as seen in YGGT_ECOLI. Residues 12-73 are 33% similar to a domain of the hypothetical YC19_PORPU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 80 (E-value = 4.8e-34) place CT645 in the YGGT family which is described as YGGT family (PF02325)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
47  
67
transmembrane  
71  
91

PDB Hit:
None.

Gene Protein Sequence:
MLSYLLRTAVNIYSFLILVYVLCSWLPECHNTQWYRIIRRWVSPYLRIFH
KFVPRIGFIDISPMIALLCLGVLPFMILKILRFIVLNIFQSPWLLQYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTTCTTATTTACTTAGAACTGCGGTTAATATTTATAGTTTTTTAAT
TTTGGTTTACGTTCTTTGTTCCTGGCTGCCAGAATGCCACAATACACAGT
GGTATCGCATCATTCGTCGCTGGGTATCTCCCTATCTCCGTATCTTCCAT
AAATTCGTTCCTCGTATAGGGTTTATTGACATCAGCCCTATGATCGCTCT
CCTCTGCCTCGGAGTTTTGCCCTTCATGATTCTAAAAATTTTACGTTTCA
TTGTTCTGAATATTTTTCAATCACCATGGCTCCTTCAATATTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy