Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR534 IGR529 IGR530 IGR532 IGR533 IGR531 CT642 CT644 recC, - CT640 CT648 CT646 CT641 CT643 CT642 CT644 recC, - CT640 CT648 CT646 CT641 CT643 CT642 CT644 recC, - CT640 CT645 CT645 CT646 CT641 CT643 CT647 CT648 CT647
* Calculated from Protein Sequence

Gene ID: CT643

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
DNA topoisomerase I

Gene Start:
737335

Gene Stop:
739905

Gene Length:
2571

Molecular Weight*:
96699

pI*:
9.03

Net Charge*:
20.64

EC:
5.99.1.2  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
From Prosite PDOC00333:

DNA topoisomerase I (EC 5.99.1.2) is one of the two types of enzyme that catalyze the interconversion of topological DNA isomers. Type I topoisomerases act by catalyzing the transient breakage of DNA, one strand at a time, and the subsequent rejoining of the strands. When a prokaryotic type I topoisomerase breaks a DNA backbone bond, it simultaneously forms a protein-DNA link where the hydroxyl group of a tyrosine residue is joined to a 5'-phosphate on DNA, at one end of the enzyme-severed DNA strand.

Prokaryotic organisms, such as Escherichia coli, have two type I topoisomerase isozymes: topoisomerase I (gene topA) and topoisomerase III (gene topB). So far the only non-prokaryotic members of this family have been found in yeast and in human: TOP3, which are evolutionary related to prokaryotic topoisomerase III.

Blast Summary:  PSI-Blast Search
CT643 is orthologously related to CPn0769: residues 1-855 are 70% similar to residues 1-861 of CPn0769. Numerous hits in gapped BLAST to topoisomerase I proteins, e.g., residues
1-781 are 40% similar to TOP1_BACSU. CT643 is similar to TP0394, a predicted DNA topoisomerase I in T. pallidum.
It is also similar to MG122 in M. genitalium.



COGS Summary:  COGS Search
BeTs to 16 clades of COG0550
COG name: Topoisomerase IA
Functional Class:  L
The phylogenetic pattern of COG0550 is amtkyqvcEBrHUJgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 84-511 span seven regions of similarity to blocks BL00396A-F, which
consist of prokaryotic topoisomerase sequences. Residues 518-533 are similar
to block PR00671D, inhibin beta B signature. Residues 653-670 and 559-573 are
similar to blocks PR00848A,F, sperm surface proteins.

ProDom Summary:  Protein Domain Search
Residues 1-569 are 40% similar to a topoisomerase domain of TOP1_SYNY3.
Residues 595-624, 609-725, 787-823 are also similar to topoisomerase domains,
e.g. in YRDD_ECOLI. Residues 786-857 are similar to a hypothetical domain of YM74_YEAST.

Paralogs:  Local Blast Search
CT643 is weakly paralogous to CT460, a predicted SwiB complex protein.

Pfam Summary:  Pfam Search
Residues 3 to 110 (E-value = 3.4e-37) place CT643 in the Toprim family which is described as Toprim domain (PF01751)
Residues 124 to 555 (E-value = 2.7e-152) place CT643 in the Topoisom_bac family which is described as DNA topoisomerase (PF01131)
Residues 592 to 631 (E-value = 9.8e-05) place CT643 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 645 to 683 (E-value = 2.2e-11) place CT643 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 695 to 734 (E-value = 1.6e-06) place CT643 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 779 to 854 (E-value = 2e-35) place CT643 in the SWIB family which is described as SWIB/MDM2 domain (PF02201)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
217  
264
coil-coil  
433  
474
non-globular  
717  
857

PDB Hit:
gi|1127274|pdb|1ECL| Molecule: Escherichia coli topoisomerase I; Domain: amino-terminal 67kDa; Synonym: Escherichia coli omega protein; Mutation: Gly Ser insertion at N-terminus, insertion of stop codon at 598; Engineered; Ec: 5.99.1.2.

Gene Protein Sequence:
MKKSLIIVESPAKIKTLRKLLGEGFIFDSSLGHIVDLPAKGFGIDIENGF
VPDYQILEGKKEVIRKICAEAKKCDVVYLAPDPDREGEAIAWHIANQLPK
DTKIQRISFNAITKGAVTEALKHPREIDMALVNAQQARRFLDRIVGYKIS
PILGRKLQRWSGVSAGRVQSVALKLVVDREYAIERFVPVEFWNIRVHLKD
PQTQKTFWAHLHSVNGKKWEKEIPEGKTSDEVILIDSKEKADEIVALLES
ATYVVDRVESKEKKRHAYPPFITSTLQQEASRHYRFSSSRTMNIAQTLYE
GVDLDSQGAVGLITYMRTDSVRTDPEAVKQVRKYIEGHFGKEFVPSSPNV
YATKKMAQDAHEAIRPTDVTITPESIRSKLTEDQYKLYSLIWKRFVASQM
ISAIYDTLAIRITTNKGIDLRATGSCLKFKGFLAVYEEKRDEEGDEEENI
HLPKLNERDVLTKEELEAEQSHTKPLPRFTEASLVKELEKSGIGRPSTYA
TIMNKIQSREYTLKEGQRLRPTELGKVVCQFLETNFPRIMDIGFTAGMED
ELELIADNKKPWKQLLQEFCELFLPFVVTAEKEAFIPRIVTEIDCPKCHK
GKLVKIWAKNRYFFGCSEYPTCDYKTSEEELTFDKNEYAEDTPWDAPCAL
CGGEMKVRHGKFGSFLGCENYPKCHYIVNLFKKGEAGAEPEATVHCPAEG
CTGHLVKRRSRFNKMFYSCSEYPACSVIGNSVDAVIEKYAGTPKTPYEKK
PKAKKSIASTKGKAAKTVKKSSATTKKRATKAYTPSAALAAVIGADPVGR
PEATKKLWEYIKEKGLQSPQNKKIIIPDSKLQGVIGADPIDMFALSKKLS
AHLIKEE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATCCTTAATCATCGTTGAATCCCCAGCCAAGATTAAAACTTT
GCGTAAGTTGTTAGGAGAAGGGTTTATTTTTGACTCTTCCTTGGGGCATA
TTGTTGATCTTCCTGCAAAAGGGTTTGGTATTGATATTGAAAATGGATTT
GTTCCGGACTACCAAATTTTAGAAGGGAAGAAAGAGGTTATTCGGAAAAT
TTGCGCCGAAGCGAAAAAATGTGATGTAGTTTATCTCGCTCCCGATCCAG
ACCGAGAAGGAGAGGCTATAGCATGGCATATCGCGAATCAGCTGCCTAAG
GATACTAAAATTCAACGTATTTCATTCAATGCCATTACTAAAGGAGCTGT
TACCGAAGCTTTGAAGCATCCTAGGGAAATTGATATGGCGTTGGTCAATG
CACAGCAGGCACGACGCTTTCTAGATCGCATTGTGGGATACAAGATCTCT
CCGATCCTAGGTCGCAAGCTGCAACGTTGGTCTGGGGTTTCTGCAGGAAG
AGTGCAGTCTGTAGCTCTTAAATTAGTAGTAGATCGGGAATATGCTATAG
AACGATTTGTTCCCGTCGAATTTTGGAATATCCGAGTGCATCTTAAAGAT
CCTCAAACCCAAAAGACATTCTGGGCTCATTTGCATTCCGTGAATGGGAA
GAAATGGGAAAAAGAAATTCCTGAAGGGAAGACTTCTGATGAAGTGATTT
TAATTGATTCTAAAGAGAAGGCAGATGAGATTGTCGCTCTATTAGAATCA
GCTACATATGTTGTAGATCGTGTAGAGTCTAAAGAGAAAAAACGTCACGC
CTATCCTCCGTTTATTACTTCTACGTTGCAGCAAGAAGCTAGTCGTCATT
ACCGCTTTTCCTCTTCCAGAACGATGAACATAGCGCAGACTTTATATGAA
GGGGTAGATTTAGATAGTCAAGGTGCTGTGGGATTGATCACATACATGCG
AACCGATTCCGTACGTACGGATCCTGAAGCTGTAAAACAGGTGCGCAAAT
ATATCGAAGGTCATTTTGGTAAGGAATTCGTTCCTTCTTCTCCGAACGTG
TATGCCACGAAAAAAATGGCACAGGATGCACACGAAGCTATACGTCCTAC
AGATGTTACAATCACTCCGGAATCGATACGCAGTAAGTTAACGGAAGATC
AGTACAAGCTGTATTCTTTGATATGGAAGCGTTTTGTTGCATCACAAATG
ATATCCGCAATTTACGATACACTCGCGATTCGTATTACGACGAATAAAGG
TATCGATCTGCGTGCTACAGGCTCTTGTTTGAAATTTAAAGGGTTCTTAG
CTGTTTACGAAGAGAAAAGAGATGAAGAAGGGGATGAAGAGGAAAACATT
CATCTTCCGAAGCTTAATGAGCGAGATGTTCTAACAAAGGAAGAGTTAGA
AGCAGAACAATCGCATACCAAGCCTTTGCCGCGATTTACAGAAGCTTCTT
TAGTGAAAGAACTCGAGAAGTCAGGAATAGGGAGACCTTCTACCTATGCC
ACTATCATGAATAAAATCCAGAGTCGGGAATATACGTTGAAAGAAGGGCA
AAGGCTACGTCCTACTGAATTAGGAAAAGTAGTTTGTCAGTTTTTAGAAA
CGAATTTTCCTCGTATTATGGATATTGGTTTTACCGCTGGCATGGAAGAT
GAGTTAGAACTGATTGCTGATAATAAAAAACCTTGGAAGCAGCTATTACA
AGAATTTTGTGAACTCTTTCTTCCTTTTGTAGTCACGGCAGAAAAAGAAG
CCTTTATCCCTCGTATTGTGACAGAAATAGACTGTCCAAAATGTCATAAA
GGGAAATTAGTAAAAATTTGGGCTAAAAATCGCTATTTCTTTGGTTGCTC
CGAATATCCTACTTGCGACTATAAAACTTCGGAAGAGGAGCTGACGTTCG
ACAAAAACGAGTATGCTGAAGACACTCCTTGGGACGCACCCTGTGCTCTG
TGCGGAGGAGAAATGAAAGTCCGGCATGGGAAATTTGGAAGTTTCCTTGG
CTGCGAGAACTATCCGAAGTGTCACTACATTGTTAATCTTTTCAAAAAGG
GAGAAGCTGGGGCTGAGCCTGAAGCGACAGTGCATTGTCCTGCAGAAGGA
TGTACAGGACACCTTGTGAAAAGACGCTCACGATTTAATAAAATGTTTTA
TTCTTGCTCCGAATATCCTGCATGTAGCGTGATTGGTAACTCTGTAGATG
CTGTAATTGAAAAGTATGCAGGAACGCCTAAAACTCCTTATGAGAAGAAA
CCAAAAGCGAAAAAATCAATAGCCTCTACCAAGGGAAAGGCTGCAAAAAC
AGTGAAAAAAAGCTCAGCAACAACAAAAAAACGAGCTACCAAAGCGTACA
CACCTTCTGCTGCTTTAGCAGCGGTGATTGGTGCGGATCCTGTAGGGCGT
CCCGAAGCCACTAAGAAGCTATGGGAGTATATTAAGGAAAAAGGATTGCA
ATCCCCTCAAAATAAAAAAATCATTATTCCTGATAGTAAATTGCAGGGAG
TGATAGGAGCTGATCCAATCGACATGTTCGCGCTATCTAAAAAATTAAGC
GCGCACTTAATCAAGGAAGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy