Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 IGR528 IGR529 IGR526 recC, - CT640 recB, - CT639 CT638.1 tyrB, - CT637 CT641 greA, - CT636 recC, - CT640 recB, - CT639 CT638.1 tyrB, - CT637 CT641 greA, - CT636 recC, - CT640 recB, - CT639 tyrB, - CT637 CT641 greA, - CT636 CT638 CT638.1 CT638
* Calculated from Protein Sequence

Gene ID: CT639

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recB  

Definition:
exodeoxyribonuclease V beta chain

Gene Start:
730897

Gene Stop:
727820

Gene Length:
3078

Molecular Weight*:
117826

pI*:
6.97

Net Charge*:
-0.56

EC:
3.1.11.5  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
In HAEIN and ECOLI, this enzyme manifests a range of exonucleolytic and endonucleolytic activities. It consists of three subunits; see CT640 and CT033 for the gamma and alpha subunits.
The intergenic spacing between CT639 and CT640 is 5 bp.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Exodeoxyribonuclease V beta chain
protein sequences, e.g. residues 19-732 are 24% and residues 918-995 are 28% similar
to EX5B_HAEIN. CT639 is similar to TP0102, a predicted DNA-dependent ATPase
from T.pallidum. It is also similar to MG244 of M.genitalium.

CT639 is orthologously related to CPn0738:residues 4-1021 are 44% similar to CPn0738.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1074
COG name: ATP-dependent exoDNAse (exonuclease V), beta subunit, - helicase and exonuclease domains
Functional Class:  L
The phylogenetic pattern of COG1074 is --------ebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 504-538, 830-863, 290-308 are matched to blocks BL00419F,H,I.
concerned with Photosystem I psaA and psaB proteins, represented by PSAA_CHLRE.

ProDom Summary:  Protein Domain Search
Residues 13-349 are 26% similar to an exodeoxyribonuclease beta
chain domain as observed in EX5B_ECOLI.
Residues 515-732 and 912-1015 are also similar to exodeoxyribonuclease domains
as observed in EX5B_ECOLI, EX5B_HAEIN.
Residues 13-67 and 367-409 are related to helicase domains,
e.g. in REP_ECOLI, EX5B_HAEIN.

Paralogs:  Local Blast Search
CT639 is paralogously related to CT608, concerned with Helicase SF1 UvrD
sequences, residues 319-739 are 23% similar to CT608.

Pfam Summary:  Pfam Search
Residues 2 to 650 (E-value = 2.1e-166) place CT639 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
735  
912

PDB Hit:
gi|2781090|pdb|1PJR| Structure Of Dna Helicase Dna Repair, Dna Replication, Sos Response, Helicase, Atp-Binding, Dna-Binding Mol_id: 1; Molecule: Pcra; Chain: Null; Engineered: Yes

Gene Protein Sequence:
MSSFDIFSPTASVSGKFFLEASAGTGKTFTIEQVVLRSLLEGSIEQTKNI
LVVTFTNAATNELKLRIQASLKQALSLFSQALSHPGTPLPPYISSSETKV
KQLYMKIRNSLATLDEMNIFTIHGFCRFTLEQHFPWIQPIQPSSIFSEPQ
TIQQHILDYLRKNLWDTVLSPKQYAFLSYHHRATTQQTRHLIERLLQDYT
STPNLALSPLSITLQKLKAWVSRYQHLAPLSLEEMQAFSLRFKQSDLSIE
RELPAFVQQFETNPYSLDMLFFPGMVQKFQEENRNKKKLSAPASPLDPFF
QDWIQLAHPFCQKEPIFHTLLKSVQQHLKTHCAQSYSHDESIATLESLLA
HNDTVVSQLRKQFQLVLIDEFQDTDKRQWQIFSKLFASPDYSGSLFLIGD
PKQSIYEWRNADLPTYLQAKHSFPKEAQLILDTNYRSTPELMQALNHLFS
LPTPFLETPQNILYHPLHSKGSAEISYSEFSPIHFFSSEDIQEETLWISK
TASYLRSAYSIPFGNMAVLVQDYPQALKLITHSTIPMAYCKEKRIFDRTE
SPYLLILLLEALLYPENQQKIQAILMSRLFQLSSTEIHQHLKTFSSLFFT
LNRHLYHYSLLATFYKLMGENVLSQTIGETLLQTPLGDIIFQELEALCLY
LDKTTENPHHKLLHLINILITGKYDEELSFSSQSNDENMIKITTVHSSKG
LEYDVVFCSCLNKAKEKTPSVHMREMYVACTRAKKFLFIPFSPIEKRSLS
TKKLSALANYANVTKHHSVPHLVETLTSSSPELFSSSFQPPESSLTPDRE
RLPQQTYFSLPHLPSRTIHSFSSTVENLHFSEPIQELSPSLLFPGGSLTG
TLIHKLLESLAGNFAACFEEIFNKAQTLLKNTPLEGYESIIAEKICTVFS
TTLPFSSGSFALRNVHPHNIRAEETFLLQEEGELWQGIVDLFFEHKDRFF
IIDWKTSFLGDETSCYSPDQLHLYIQRQGLDRQERLYRKAAKRFLHQFNS
LLQVEMAFVFIRGLDDKGNGFLQPGR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTCTTTTGATATTTTTTCACCAACAGCTTCTGTTTCTGGGAAATT
TTTCTTAGAAGCTTCTGCAGGAACTGGGAAAACATTCACTATAGAACAAG
TGGTTCTTCGCTCGTTATTAGAAGGATCGATCGAACAGACAAAGAACATT
CTGGTAGTTACATTCACCAACGCAGCTACCAATGAATTAAAACTGCGTAT
TCAAGCAAGCCTCAAACAAGCATTGAGTCTTTTCTCCCAAGCACTCTCTC
ATCCCGGGACTCCCTTACCTCCCTATATCTCTTCCTCAGAAACAAAAGTA
AAACAGCTTTACATGAAGATCCGTAATAGCCTGGCCACTTTAGATGAAAT
GAACATCTTTACTATTCATGGATTTTGTCGTTTTACACTGGAGCAACACT
TCCCTTGGATACAGCCTATTCAGCCGTCTTCTATTTTCTCAGAGCCTCAA
ACCATACAACAGCATATCCTAGACTACTTACGTAAAAATCTTTGGGACAC
GGTTCTCTCTCCCAAACAATACGCCTTCTTATCTTATCATCACCGCGCTA
CTACCCAACAAACACGCCACCTAATAGAGAGACTACTTCAAGATTACACT
TCCACACCAAATTTAGCGCTCTCGCCTCTATCGATAACCCTGCAAAAACT
AAAAGCTTGGGTCTCCCGCTACCAACACTTAGCTCCTCTCTCTCTCGAGG
AAATGCAAGCTTTCTCTCTTCGTTTTAAACAAAGCGATCTCTCTATCGAG
CGGGAACTCCCCGCTTTTGTGCAACAATTCGAAACCAATCCTTATTCTTT
GGATATGCTGTTTTTCCCAGGAATGGTACAGAAGTTTCAGGAGGAAAACC
GCAATAAGAAAAAATTAAGTGCTCCAGCTTCTCCTTTAGATCCTTTTTTC
CAAGATTGGATACAGTTAGCTCATCCTTTTTGCCAAAAAGAACCTATTTT
CCATACGCTACTTAAAAGCGTGCAACAACATCTGAAAACTCACTGCGCAC
AATCCTATTCCCATGATGAAAGCATAGCCACTTTAGAATCTCTTCTAGCT
CACAACGATACTGTCGTCTCACAACTACGTAAACAATTTCAGCTAGTCTT
GATCGATGAATTCCAAGACACTGACAAACGTCAGTGGCAGATCTTTTCTA
AACTCTTTGCTTCTCCAGACTATTCAGGATCCCTTTTTCTTATCGGAGAC
CCTAAACAGTCTATTTATGAATGGAGAAATGCAGACCTCCCCACATACTT
GCAAGCAAAACACTCCTTCCCAAAAGAAGCTCAGCTTATTTTAGATACAA
ATTACCGATCCACCCCAGAGCTTATGCAAGCTCTCAACCATTTGTTTTCT
CTTCCCACACCGTTTCTAGAGACTCCACAAAACATTCTGTATCACCCTTT
ACATTCTAAAGGGAGCGCGGAGATCTCCTACTCAGAGTTCAGTCCTATTC
ATTTCTTCTCCTCAGAAGACATTCAAGAAGAAACGTTATGGATTTCTAAA
ACCGCTTCTTATCTTCGATCAGCGTATTCCATTCCATTTGGAAATATGGC
TGTTCTAGTACAAGACTATCCACAGGCTCTGAAGCTAATCACTCACAGCA
CCATCCCCATGGCCTACTGCAAAGAAAAACGTATTTTTGATCGCACAGAA
TCCCCCTACCTTCTGATTCTACTATTGGAAGCCCTTCTGTACCCAGAGAA
TCAACAAAAGATTCAAGCCATTTTGATGAGCCGGCTATTTCAGCTTTCCT
CTACGGAGATTCACCAGCATCTTAAAACGTTTTCTTCTTTGTTTTTCACT
CTGAATCGACATCTCTACCACTATTCTCTATTAGCTACCTTCTATAAGCT
GATGGGAGAAAACGTTTTATCTCAAACCATAGGAGAAACATTATTGCAAA
CCCCTCTTGGAGATATCATTTTCCAAGAATTAGAAGCGCTATGCTTGTAT
CTTGATAAAACTACAGAGAATCCCCATCACAAACTCTTACATCTCATCAA
TATTCTGATTACAGGGAAGTATGATGAAGAGCTTTCTTTCTCGTCGCAAT
CTAATGACGAGAATATGATAAAAATTACGACCGTTCACTCTTCAAAAGGG
CTCGAATACGATGTAGTATTTTGCTCTTGCCTTAACAAAGCAAAAGAGAA
AACTCCTTCTGTTCATATGCGAGAAATGTATGTCGCATGCACAAGAGCCA
AAAAATTCTTATTTATTCCGTTTTCTCCTATAGAGAAACGCTCACTAAGC
ACAAAAAAACTTTCTGCTCTTGCTAACTATGCTAATGTTACAAAACATCA
TAGCGTTCCTCATTTAGTAGAAACCTTGACTTCCTCATCTCCGGAACTAT
TTTCATCCAGCTTCCAACCTCCTGAAAGCTCTCTAACTCCGGATAGAGAA
CGTCTTCCTCAACAAACATACTTTTCTCTTCCACATCTCCCTTCTCGAAC
TATTCACTCTTTCTCTTCTACGGTAGAGAATCTTCACTTTTCGGAACCTA
TTCAAGAACTGTCACCCTCTCTTTTATTTCCTGGAGGCTCTCTAACAGGA
ACGTTGATTCATAAACTTTTAGAATCATTAGCAGGGAATTTTGCTGCTTG
TTTTGAAGAAATTTTCAATAAAGCTCAGACATTATTGAAAAACACTCCTT
TAGAAGGATACGAGTCTATTATTGCAGAAAAAATCTGTACGGTCTTTTCA
ACGACTCTTCCTTTTTCTTCCGGATCCTTTGCTCTCAGGAATGTACATCC
TCATAACATACGTGCAGAGGAAACTTTCTTACTACAAGAAGAAGGAGAGC
TATGGCAAGGAATCGTCGACTTGTTTTTTGAACATAAGGATCGATTTTTT
ATCATCGACTGGAAAACTTCTTTCTTAGGAGATGAAACCTCTTGCTATTC
CCCAGATCAACTCCATCTCTATATTCAACGTCAAGGGTTAGATAGACAGG
AGAGATTGTACAGAAAAGCAGCGAAAAGGTTCCTACACCAATTTAATTCA
TTATTGCAAGTAGAAATGGCCTTCGTATTTATCCGAGGCTTGGATGACAA
GGGCAATGGATTTTTGCAACCAGGACGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy