Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 tRNA-Pro-2 IGR524 IGR523 IGR519 IGR525 IGR520 IGR521 IGR526 IGR522 CT635 glmU, - CT629 tctD, - CT630 nqrA, - CT634 CT632 CT631 hemB, - CT633 tyrB, - CT637 greA, - CT636 CT635 glmU, - CT629 tctD, - CT630 nqrA, - CT634 CT632 CT631 hemB, - CT633 tyrB, - CT637 greA, - CT636 CT635 tctD, - CT630 nqrA, - CT634 CT632 glmU, - CT629 CT631 hemB, - CT633 tyrB, - CT637 greA, - CT636 CT638 CT638
* Calculated from Protein Sequence

Gene ID: CT634

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrA  

Definition:
Na+-translocating NADH-ubiquinone oxidoreductase alpha chain

Gene Start:
722710

Gene Stop:
721316

Gene Length:
1395

Molecular Weight*:
51746

pI*:
9.36

Net Charge*:
8.25

EC:
1.6.5.3  

Functional Class:
cofactor biosynthesis; ubiquinone and quinones  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
CT634 is orthologously related to CPn0743: residues 1-460 are 66% similar to residues 1-459 of CPn0743. Hits in gapped BLAST to hypothetical proteins and outer membrane proteins, e.g.
residues 3-459 are 28% similar to Y164_HAEIN and also to a putative Na+-translocating
NADH-ubiquinone oxidoreductase alpha chain sequence from V. alginolyticus (S51015). No
similarities to T. pallidum or M. genitalium.



COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 2-12 are similar to block BL00358A, concerned with ribosomal L5 proteins.

ProDom Summary:  Protein Domain Search
Residues 3-386 and 394-459 are 28% and 36% similar to hypothetical domains of Y164_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 460 (E-value = 4.6e-261) place CT634 in the NQRA family which is described as Na(+)-translocating NADH-quinone reductase subunit A (NQRA) (PF05896)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
249  
273

PDB Hit:
None.

Gene Protein Sequence:
MKIVVSRGLDLSLKGAPKESGFCGKVDPTYVSVDLRPFAPLPLGVKVTPE
DQVTAGSPLAEYKLFSGVFITSPVDGEVVEIRRGNKRALLEIVIKKKPGI
SQTKFSYDLQSLTQKDLLEVFKKEGLFALFKQRPFDIPALPTQSPRDVFI
NLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFGLKPHIISTD
RLTLPTQDLVSIAHLHTIDGPFPSGSPSTHIHHIARIRNERDVVFTISFQ
EVLSIGHLFLKGFVLGQQIVALAGSALPPSQRKYLITAKGASFSDLLPKD
IFSSDEITLISGDPLTGRLCKKEENPCLGMRDHTITLLPNPKTRESFSFL
RLGWNKLTVTRTYLSGFFKRKRVFMDMDTNMHGEKRPIIDAEIYERVSAI
PVPVALIIKALETQNFEEACRLGLLEVAPEDFALPTFIDPSKTEMFSIVK
ESLLRYAKENVVTSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATAGTTGTTTCTCGCGGATTAGATCTGTCTTTAAAGGGAGCTCC
GAAGGAATCGGGTTTTTGCGGTAAGGTGGACCCCACCTATGTTTCCGTGG
ATTTGAGGCCTTTCGCTCCCCTTCCTTTAGGGGTAAAGGTTACTCCAGAA
GACCAAGTTACTGCTGGTTCTCCCCTGGCTGAGTACAAGCTTTTTTCAGG
AGTGTTTATTACCTCTCCTGTTGATGGAGAGGTTGTAGAGATCCGTAGAG
GAAATAAACGTGCTCTTTTAGAGATCGTCATCAAGAAGAAGCCTGGTATT
TCTCAAACTAAGTTTTCTTATGATCTTCAATCTTTGACTCAAAAAGATCT
TTTAGAAGTTTTTAAAAAGGAAGGTCTTTTCGCTCTTTTCAAACAAAGAC
CTTTTGATATCCCAGCTCTTCCAACACAATCTCCTCGAGATGTTTTTATT
AACTTAGCGGATAATCGCCCTTTCACCCCTTCTGTGGAAAAACATCTCAG
TCTTTTTTCTTCAAAAGAAGATGGTTATTACATTTTTGTTGTGGGAGTTC
AGGCAATAGCAAAACTATTTGGACTGAAGCCTCATATCATTTCTACAGAC
AGACTAACTCTCCCAACCCAGGATCTCGTATCCATAGCCCACTTACACAC
AATAGATGGCCCCTTCCCATCAGGATCTCCTTCAACGCACATTCATCACA
TCGCTCGTATTCGAAACGAAAGAGATGTTGTGTTTACTATTAGCTTCCAA
GAGGTGTTATCTATAGGGCATCTATTTTTAAAAGGCTTTGTTTTAGGACA
ACAAATCGTTGCCTTAGCAGGATCAGCTCTTCCTCCTTCTCAAAGAAAAT
ATCTCATTACTGCGAAAGGCGCTAGTTTCTCTGATCTTCTTCCTAAAGAC
ATTTTCTCTTCCGATGAGATTACCCTTATTTCTGGAGATCCTCTTACAGG
AAGATTATGTAAAAAAGAAGAAAATCCTTGTTTAGGTATGAGAGACCATA
CCATAACACTTCTTCCTAATCCTAAAACTCGTGAATCTTTCAGTTTCTTG
CGCTTAGGTTGGAATAAACTTACAGTCACACGAACCTATCTATCTGGTTT
TTTCAAGAGAAAACGGGTCTTCATGGATATGGATACTAACATGCATGGAG
AAAAACGGCCCATTATTGATGCTGAAATCTATGAGCGTGTTTCAGCAATC
CCGGTTCCTGTAGCTCTTATTATTAAAGCTTTGGAAACACAAAACTTTGA
AGAAGCGTGTCGCCTAGGGCTCTTAGAAGTTGCTCCAGAAGATTTTGCTC
TCCCCACATTCATAGATCCTTCTAAGACCGAGATGTTCTCTATCGTCAAA
GAATCTCTTTTACGCTACGCAAAAGAGAATGTGGTAACCTCCTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy