Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 tRNA-Pro-2 IGR524 IGR523 IGR519 IGR518 IGR525 IGR520 IGR521 IGR526 IGR522 CT635 glmU, - CT629 tctD, - CT630 ispA, - CT628 nqrA, - CT634 CT632 CT631 hemB, - CT633 tyrB, - CT637 greA, - CT636 CT635 glmU, - CT629 tctD, - CT630 ispA, - CT628 nqrA, - CT634 CT632 CT631 hemB, - CT633 tyrB, - CT637 greA, - CT636 CT635 glmU, - CT629 tctD, - CT630 ispA, - CT628 nqrA, - CT634 CT632 CT631 hemB, - CT633 tyrB, - CT637 greA, - CT636
* Calculated from Protein Sequence

Gene ID: CT633

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemB  

Definition:
delta-Aminolevulinic acid dehydratase

Gene Start:
720271

Gene Stop:
721284

Gene Length:
1014

Molecular Weight*:
37724

pI*:
6.71

Net Charge*:
-1.34

EC:
4.2.1.24  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Comment:
Responsible for the second step in heme biosynthesis, formation of porphobilinogen.
Typically a homomer of eight subunits.

From Prosite PDOC00153:
Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) (AlaD) catalyzes the second step in the biosynthesis of heme, the condensation of two molecules of 5-aminolevulinate to form porphobilinogen. The enzyme is an oligomer composed of eight identical subunits. Each of the subunits binds an atom of zinc or of magnesium (in plants). A lysine has been implicated in the catalytic mechanism. The sequence of the region in the vicinity of the active site residue is conserved in AlaD from various prokaryotic and eukaryotic species.

Blast Summary:  PSI-Blast Search
CT633 is orthologous to CPn0744: residues 1-326 are 63% similar to CPn0744. Several hits in gapped BLAST to Hem2 delta-aminolevulinic acid dehydratase
sequences, e.g. residues 4-326 are 51% similar to HEM2_BRAJA. No similarities to T. pallidum or M. genitalium.



COGS Summary:  COGS Search
BeTs to 12 clades of COG0113
COG name: Delta-aminolevulinic acid dehydratase
Functional Class:  H
The phylogenetic pattern of COG0113 is amt-yq-cebr-uj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 9-319 span eight regions of similarity to blocks BL00169A-G,
concerned with delta-aminolevulinic acid dehydratase.

ProDom Summary:  Protein Domain Search
Residues 20-326 are 51% similar to a porphobilinogen lyase (HEM2) domain
as observed in HEM2_BRAJA.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.


Pfam Summary:  Pfam Search
Residues 5 to 326 (E-value = 1.4e-169) place CT633 in the ALAD family which is described as Delta-aminolevulinic acid dehydratase (PF00490)

PDB Hit:
None.

Gene Protein Sequence:
MIRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIK
SMPGVYRWSLDMVSKELERLCTIGLKAVILFPVIDANKKEQFGSYASHPY
NIVCKGIQAIKKSFPELCVISDIALDPFTTSGHDGIFHNNYVINDESVRV
YGGIAVMHAEMGADIVAPSDMMDGRVKHIREQMDQMGFVNTGILSYSAKY
ASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALLECQLDEEEGADMVM
IKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKESVIK
ESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAGGCTTCCATTACTAAAACGACCTCGCAGAAACCGAAAAAGTGC
AGCCGTTCGATCTATAATTCAAGAAACCCAACTCTGTTCTAGTGACTTGA
TCTGGCCCATCTTTCTTAAAGATGGCTCTGGAATTCGAGAAGAAATAAAG
AGTATGCCTGGAGTATACAGATGGAGTTTAGACATGGTCTCTAAAGAGTT
AGAGAGACTTTGTACGATAGGATTGAAAGCTGTTATCCTCTTTCCTGTAA
TTGATGCTAATAAAAAAGAACAATTTGGATCCTATGCGTCGCATCCTTAC
AACATTGTTTGTAAAGGGATTCAAGCGATAAAAAAATCTTTTCCAGAATT
ATGTGTCATCAGTGACATAGCTTTAGATCCTTTTACAACCAGTGGTCACG
ATGGGATTTTTCATAATAACTACGTTATCAATGATGAAAGTGTCCGTGTA
TATGGGGGTATCGCTGTCATGCATGCGGAAATGGGAGCAGATATTGTTGC
TCCTAGCGATATGATGGATGGGAGAGTGAAGCATATTCGAGAGCAGATGG
ATCAGATGGGGTTTGTCAACACGGGTATTCTCTCGTACAGTGCAAAATAT
GCATCTGCATTGTATGGCCCATTTCGGGATGCTCTTTCTTCACATCTTCA
GTCTGGAGATAAGCGTACATATCAAATGGATCCTGCCAATGTTCAAGAAG
CGTTGCTAGAGTGTCAGTTAGATGAAGAAGAAGGCGCTGATATGGTGATG
ATAAAACCCGCAGGTTTTTATCTAGATGTAATCGTTAAAGCGAGAGAAAA
CACCCATCTTCCGGTGGTAGCCTATCAAGTCAGCGGGGAATTTTCTATGA
TTATGGCTGCTTGCCTTCATGGGTGGTTAAACAAAGAAAGTGTAATAAAA
GAATCTTTATTAGCGATTAAGAGAGCTGGTGCAACAGCTATAATTAGTTA
CGCAACACCATGGGTTTTAGAATGGCTAGCTAAAGATGCTCTTCCCTTTG
AGAGAAGTGTTCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy