Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 IGR523 IGR519 IGR518 IGR517 IGR515 IGR514 IGR520 IGR521 IGR522 IGR516 glmU, - CT629 rpsD,rs4, - CT626 tctD, - CT630 ispA, - CT628 nqrA, - CT634 CT632 mviN, - CT624 CT631 end4, - CT625 CT627 hemB, - CT633 glmU, - CT629 rpsD,rs4, - CT626 tctD, - CT630 ispA, - CT628 nqrA, - CT634 CT632 mviN, - CT624 CT631 end4, - CT625 CT627 hemB, - CT633 glmU, - CT629 rpsD,rs4, - CT626 tctD, - CT630 ispA, - CT628 nqrA, - CT634 CT632 mviN, - CT624 CT631 end4, - CT625 CT627 hemB, - CT633
* Calculated from Protein Sequence

Gene ID: CT629

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glmU  

Definition:
UDP-N-acetylglucosamine pyrophosphorylase

Gene Start:
717034

Gene Stop:
716420

Gene Length:
615

Molecular Weight*:
22314

pI*:
7.89

Net Charge*:
4.26

EC:
2.7.7.23  

Functional Class:
cell envelope; peptidoglycan  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:
This bifunctional enzyme is responsible for the acetylation of
GLC-N-1-P to yield GLCNAC-1-P and UDP-GLCNAC. See CT816 for the glmS sequence.

Blast Summary:  PSI-Blast Search
CT629 is orthologously related to CPn0749: residues 3-204 of CT629 are 64%
similar to residues 4-208 of CPn0749, a predicted UDP-N-acetylglucosamine
pyrophosphorylase from C. pneumoniae.

Hits in gapped BLAST to glucose-1-phosphate thymidylyltransferase homologs, e.g., residues 26-204 are 32% similar to the enzyme in Methanobacterium thermoautotrophicum (AE000918). No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0110
COG name: Acetyltransferases (the isoleucine patch superfamily)
Functional Class:  R
The phylogenetic pattern of COG0110 is -Mt-y-vCEBR-------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 78-155 are 38% similar to a UDP-N-Acetylglucosamine pyrophosphorylase domain represented by GLMU_ECOLI.

Paralogs:  Local Blast Search
CT629 is weakly paralogous to CT243, concerned with UDP-3-O-[3-HYDROXYMYRISTOYL]
GLUCOSAMINE N-ACYLTRANSFERASE, residues 66-198 are 25% similar to CT243.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
gi|1311000|pdb|1LXA| Udp N-Acetylglucosamine Acyltransferase Transferase, Acyltransferase, Lipid A Biosynthesis, Lipid Synthesis Mol_id: 1; Molecule: Udp N-Acetylglucosamine O-Acyltransferase; Chain: Null; Synonym: Lpxa; Ec: 2.3.1.129; Engineered: Yes;

Gene Protein Sequence:
MVLSSSLFSPEEFLYPEIVSQAEFVWSILTLLEEKLASHTFSGIHGHLEE
GVYLKNKETIEIQEGAYVESGAYICGPCIIGPYTQVRHGAYIRGGVITSS
HCVIGHCSEIKNSYLGHHAKAAHFAYVGDSVFGSRVNLGAGVRCANFRLD
GKTIFFHHSGERCNTKRKKLGAFLGRGVSVGCNTVLNPGCYVASATKILP
NQTIY

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTATCATCCTCCTTATTTTCACCAGAAGAGTTTCTTTATCCAGA
GATCGTAAGCCAAGCTGAATTTGTTTGGTCTATTTTGACTTTGTTAGAAG
AGAAACTAGCTTCTCATACTTTTTCAGGAATCCATGGGCATCTTGAAGAA
GGGGTGTATCTAAAAAATAAAGAGACTATCGAAATCCAAGAAGGAGCTTA
CGTAGAATCTGGGGCTTATATTTGTGGTCCTTGTATTATCGGTCCCTATA
CGCAAGTGCGTCATGGTGCATATATTCGAGGCGGTGTAATAACTAGCTCA
CATTGCGTTATAGGACACTGTTCTGAGATTAAAAACAGCTATTTAGGGCA
TCACGCGAAAGCTGCTCACTTTGCTTATGTAGGAGATTCTGTTTTTGGTT
CCAGAGTGAATCTAGGGGCAGGAGTTCGTTGTGCAAACTTTAGATTAGAT
GGCAAAACCATTTTCTTCCATCATTCTGGAGAGCGTTGTAATACAAAACG
GAAAAAGTTAGGAGCTTTCCTAGGTAGAGGAGTAAGTGTTGGGTGTAATA
CCGTACTTAATCCAGGATGTTATGTAGCCAGTGCTACAAAGATTCTTCCT
AATCAAACCATTTAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy