Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR519 IGR518 IGR517 IGR515 IGR512 IGR514 IGR520 IGR513 IGR516 glmU, - CT629 rpsD,rs4, - CT626 tctD, - CT630 ispA, - CT628 CT623 mviN, - CT624 CT622 end4, - CT625 CT627 glmU, - CT629 rpsD,rs4, - CT626 tctD, - CT630 ispA, - CT628 CT623 mviN, - CT624 CT622 end4, - CT625 CT627 glmU, - CT629 rpsD,rs4, - CT626 tctD, - CT630 ispA, - CT628 CT623 mviN, - CT624 CT622 end4, - CT625 CT627
* Calculated from Protein Sequence

Gene ID: CT625

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
end4  

Definition:
endonuclease IV

Gene Start:
712455

Gene Stop:
713318

Gene Length:
864

Molecular Weight*:
31640

pI*:
5.99

Net Charge*:
-5.97

EC:
3.1.21.2  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3'terminus of DNA strand breaks.

From Prosite PDOC00599:

DNA damaging agents such as the antitumor drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA. Amongst these is base-loss which forms apurinic/apyrimidinic (AP) sites or strand breaks with atypical 3'termini. DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3'terminus of DNA strand breaks.

AP endonucleases can be classified into two families on the basis of sequence similarity. What we call family 2 groups the enzymes listed below.

- Bacterial endonuclease IV (EC 3.1.21.2) (gene nfo).
- Mycobacterium leprae probable endonuclease (gene end).
- Yeast apurinic endonuclase APN1 (EC 4.2.99.18).
- Caenorhabditis elegans hypothetical protein T05H10.2.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to endonuclease IV sequences,e.g. residues 12-285 are
42% similar to E.coli(U00007). CT625 is similar to MG235, a predicted endonuclease IV sequence in
M.genitalium. No similarity to T.pallidum.

CT625 is orthologously related to CPn0732:
residues 1-286 are 71% similar to that of CPn0732.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0648
COG name: Endonuclease IV
Functional Class:  L
The phylogenetic pattern of COG0648 is -mtkyqv-ebr---gp--in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 71-84, 108-117, 159-198, 215-248, 260-271 are matched to
blocks BL00729A,B,C,D,E, concerned with AP endonuclease family 2
proteins, represented by APNI_CAEEL.

ProDom Summary:  Protein Domain Search
Residues 11-172 are 43% similar to a domain from a
probable endonuclease represented by END4_ECOLI.
Residues 31-75, 176-252 are 49% and 29% similar to a
endonuclease IV endodeoxyribonuclease domain in APN1-CAEEL.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 12 to 247 (E-value = 9.6e-95) place CT625 in the AP_endonuc_2 family which is described as AP endonuclease family 2 (PF01261)

PDB Hit:
none

Gene Protein Sequence:
MFILPPPQEALLGAHTSAAGGLHNALYEGRDIGATTVQLFTANQRQWKRR
TLTQEMVDQFRIALNETSLSYIMSHAGYLNNPGAPNPEILEKTRVCMHQE
IADCISLGISFVNFHPGAALSDSKESCLDRTIASFSQMAPLFENNPPLVV
LLETTAGQGSLIGSSFEELAYLIQGIKAHIPIGVCLDTCHIFAAGYDISS
VAGWEQVLKHFDAVIGLSFLRAIHLNDSVFALGKNKDRHAPIGEGCIGSD
SFCFLMQDERTRMLPKYLETPGGPDLWTKEIRYLQKVC

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTATACTTCCTCCTCCTCAAGAGGCTTTACTAGGAGCCCACACGTC
GGCTGCTGGAGGACTTCATAATGCTCTTTACGAAGGGCGCGATATCGGAG
CAACCACCGTTCAGCTATTCACTGCAAATCAACGTCAGTGGAAGCGACGA
ACATTAACTCAAGAAATGGTGGATCAGTTCCGCATAGCACTGAATGAAAC
TTCTCTATCTTACATCATGAGTCATGCTGGTTATTTAAATAACCCTGGTG
CTCCTAATCCGGAGATTCTAGAAAAAACTCGAGTGTGTATGCACCAAGAA
ATAGCAGACTGCATCTCACTCGGTATCTCTTTTGTTAACTTTCATCCGGG
AGCAGCTCTTTCTGATTCTAAAGAAAGTTGCCTCGATCGTACCATTGCTA
GTTTTTCACAAATGGCCCCCCTTTTTGAAAACAATCCTCCACTTGTTGTC
CTTCTTGAAACAACCGCAGGCCAGGGTTCCCTAATAGGAAGTTCTTTTGA
GGAACTTGCTTACCTAATTCAAGGGATTAAAGCCCACATACCCATAGGTG
TTTGTCTAGATACCTGCCATATTTTTGCCGCTGGTTACGATATTTCATCG
GTCGCGGGATGGGAGCAAGTACTCAAACATTTTGACGCAGTGATTGGATT
ATCTTTTTTACGAGCCATTCACTTAAACGATTCTGTCTTCGCTCTCGGAA
AAAATAAAGATCGTCATGCCCCTATTGGAGAAGGTTGCATAGGCTCAGAC
AGTTTTTGCTTCCTTATGCAAGATGAGCGTACCCGCATGCTACCTAAATA
CCTAGAGACTCCTGGAGGACCAGATCTGTGGACTAAAGAAATCCGTTACC
TACAAAAAGTTTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy