Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR510 IGR512 IGR509 IGR513 IGR511 CT623 CT622 CT621 CT619 CT620 CT623 CT622 CT621 CT619 CT620 CT623 CT622 CT621 CT619 CT620
* Calculated from Protein Sequence

Gene ID: CT621

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
706852

Gene Stop:
704357

Gene Length:
2496

Molecular Weight*:
92703

pI*:
4.76

Net Charge*:
-32.56

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT621 is similar to CPn0726: residues 14-830 of CT621 are 34% similar to residues 3-829 of CPn0726, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae.
CT621 is also similar to CPn0853, CPn0727, CPn0852, all predicted hypothetical proteins in C. pneumoniae.
No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
The following proteins are paralogously or weakly related to CT621:
CT620, CT711, CT619, CT712, all predicted Chlamydia-specific hypothetical proteins in C. trachomatis.



Pfam Summary:  Pfam Search
Residues 437 to 829 (E-value = 8.8e-210) place CT621 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
128  
212
coil-coil  
216  
263
coil-coil  
643  
677
coil-coil  
692  
719

PDB Hit:
None.

Gene Protein Sequence:
MNRIHRTQGSLTDYNSTLEAIAKKIAKPDSATIVSQVAQYEQFKMEQEAL
KALLVSFDQKADQRYRNLIQRLEQLDVDRQTGRSTESQHIQEKPMASLQS
ENQVVAQAVVQSDSSMPIFTGIKQSWAVRLVQGIREILDQVLVDTSLFTE
EERGDLLAIRMDAASLQDKQERLSTEDIRSLLSLSNDVMRVLQKASVSST
RQLELIQSLIDIFGTEENLEQSFAQVRLENFQAILSVIKERLTEEEFRVF
QEVSEEISSIQRTSESHLSPEHIEAIARVGGHLSAKIVESELKASQKVDL
CQRIAAMYQEQVDAVQAYHSLEQDALFVNSRQHSHFVQVISLVSSLMHSL
SPTSEEERILLNPAMMVSVLPTVRAIGLRFDFLTAEQQQMVNAAVSSLQQ
QQLDEFLGVLCAHLVVVNCQNKETGLLEGLEESFSETLSGLSNNFVLTAK
MQDILQVCSLQGFVTLANGDRYELFSYNDSGEAVCDEIALGDGFHKVLGT
MLAVALSQAEVFKQECDRFILQADSEKNMIHKRMVQGEQKSLFLTKMQTE
LNAGKTIAQTKEVEASPLPSAVASVLIDHYMPKEVEFLEKISSRLYYGNK
GSDIGNTILDAISLYVNSATYFGFANYIGQPPVVGKTRENIFAGSADNAK
AKLDEEKKQVDVFLEITEAAKTTVTNQQSAVTNDDKLSTEQKAKIKAELT
QYTDMLNAISNSLTSLKTQLAPLSVSTVEGVDGVFEVKNGIPGENGKNWR
LVLQTLEDTVVSGEVGSPTNIGMFQMQALVHLNQQAYADMGQNFQLELQM
HLTSMQQEWMVVATSLQLLNQIYLGLARNLLR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCGTATTCATCGTACACAAGGATCTTTAACGGATTATAATAGCAC
TCTTGAGGCTATTGCAAAGAAGATTGCCAAACCAGATTCTGCAACAATAG
TATCTCAGGTTGCTCAATATGAGCAGTTCAAAATGGAACAAGAAGCTTTA
AAAGCACTTCTTGTTTCCTTCGATCAAAAAGCAGACCAGCGATATCGAAA
TTTGATTCAACGACTGGAACAGTTGGATGTAGATAGACAAACAGGACGCT
CTACAGAGAGCCAACACATCCAAGAAAAACCGATGGCTTCTCTGCAATCT
GAAAACCAGGTTGTTGCACAAGCTGTAGTTCAGTCTGATTCTAGCATGCC
CATTTTTACAGGTATTAAACAAAGTTGGGCAGTACGATTAGTACAGGGTA
TACGTGAAATTTTGGATCAAGTCTTAGTGGACACATCCTTGTTTACGGAA
GAAGAACGGGGAGATTTACTTGCTATCCGTATGGATGCCGCTTCCCTACA
GGACAAGCAAGAGCGTTTGTCTACGGAAGATATTCGTTCTCTTCTTTCTC
TTTCGAATGATGTTATGCGAGTTTTGCAGAAAGCTTCTGTATCTAGCACG
CGGCAGCTAGAATTGATCCAATCTTTGATAGATATTTTTGGTACGGAAGA
GAATTTAGAGCAGTCCTTCGCCCAGGTACGATTGGAGAACTTCCAAGCGA
TTTTATCTGTGATTAAAGAGCGTTTGACAGAAGAAGAGTTTCGGGTATTC
CAAGAAGTCTCGGAAGAAATTTCCTCTATCCAACGCACGAGTGAATCTCA
TCTCAGTCCAGAACATATAGAGGCGATTGCTCGAGTCGGTGGGCATCTTT
CTGCTAAGATCGTGGAGTCTGAGCTGAAGGCAAGTCAGAAGGTGGATCTC
TGTCAACGAATAGCAGCTATGTACCAAGAACAAGTGGATGCGGTACAAGC
GTATCATAGTCTCGAACAAGATGCTCTATTTGTGAATTCTAGGCAACATA
GTCACTTCGTGCAGGTGATTTCTTTAGTATCCTCTCTTATGCACTCATTG
TCTCCTACTAGTGAAGAGGAGCGTATTTTACTGAACCCTGCCATGATGGT
AAGTGTTCTTCCCACTGTGCGTGCAATAGGTTTACGTTTTGACTTTTTAA
CAGCTGAGCAGCAGCAAATGGTGAATGCTGCGGTATCATCGTTGCAACAA
CAGCAGTTAGACGAATTTTTAGGAGTTCTCTGTGCGCATTTGGTTGTTGT
TAATTGCCAGAATAAAGAAACAGGTCTCTTAGAAGGTTTAGAAGAAAGCT
TTTCAGAAACGTTAAGTGGTTTGAGTAATAACTTTGTTTTGACGGCCAAA
ATGCAAGACATTTTGCAGGTTTGTTCTTTACAAGGCTTTGTCACATTAGC
AAACGGGGATCGATACGAGTTATTTTCCTATAATGATTCAGGAGAAGCGG
TATGTGATGAGATCGCTCTAGGCGATGGATTTCATAAAGTGCTAGGAACG
ATGTTAGCAGTAGCGCTTTCTCAAGCAGAGGTATTTAAGCAAGAGTGCGA
TCGATTCATTCTGCAAGCTGATTCAGAGAAGAATATGATTCACAAACGTA
TGGTTCAAGGGGAACAGAAGAGTCTATTCTTGACCAAGATGCAGACAGAG
TTGAATGCTGGGAAAACTATTGCACAAACTAAGGAAGTAGAGGCTTCTCC
GCTCCCTTCTGCCGTTGCTTCTGTATTGATTGACCACTACATGCCAAAGG
AAGTGGAGTTTTTAGAAAAGATCTCGTCTCGTCTGTATTACGGAAATAAA
GGTTCGGATATAGGCAACACCATTTTAGATGCGATTAGTTTGTATGTAAA
CTCCGCAACCTACTTTGGTTTTGCTAACTATATTGGGCAACCTCCTGTTG
TAGGTAAAACAAGGGAGAATATTTTTGCAGGGTCTGCAGATAATGCTAAA
GCCAAGTTAGACGAAGAAAAGAAACAAGTAGATGTGTTTCTAGAAATTAC
GGAAGCAGCTAAGACTACCGTCACTAATCAACAAAGTGCGGTTACTAATG
ATGACAAGTTATCTACAGAGCAGAAAGCAAAAATTAAGGCAGAGTTGACA
CAGTATACCGATATGCTTAACGCAATCAGCAATTCTTTAACATCATTGAA
AACTCAATTGGCCCCTTTATCAGTGAGTACTGTTGAAGGTGTGGATGGTG
TTTTTGAGGTTAAAAATGGTATACCAGGAGAAAACGGAAAGAACTGGAGA
TTAGTTTTACAGACTTTAGAGGATACTGTGGTATCCGGAGAAGTCGGTAG
CCCAACTAATATTGGAATGTTCCAAATGCAAGCTCTGGTACACTTGAATC
AGCAGGCCTATGCTGATATGGGACAGAATTTTCAGTTAGAGTTGCAAATG
CATCTCACTTCTATGCAACAGGAGTGGATGGTGGTAGCAACATCTCTTCA
GCTATTAAATCAAATTTATTTGGGATTAGCGCGTAATCTCTTAAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy