Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR508 IGR510 IGR509 IGR511 IGR507 CT622 CT621 CT619 CT618 CT620 CT622 CT621 CT619 CT618 CT620 CT622 CT621 CT619 CT618 CT620
* Calculated from Protein Sequence

Gene ID: CT620

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein (acidic)

Gene Start:
701774

Gene Stop:
704287

Gene Length:
2514

Molecular Weight*:
92882

pI*:
4.51

Net Charge*:
-32.42

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT620 is orthologously related to CPn0726: residues 12-838 of CT6220 are 43% similar to residues 6-831 of CPn0726, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. CT620 is also similar to CPn0727, CPn0852, CPn0853, all hypothetical proteins from C. pneumoniae. No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 338-353 are matched to block PR00364A, concerned with disease resistant protein signature sequences, e.g. NGU15605.
Residues 483-528, 772-783 are matched to blocks BL00979A,B, concerned with G-protein coupled receptors family 3 protein sequences, e.g. MGR8_HUMAN.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
CT620 is paralogously related to CT621, CT711, CT712, CT619, all hypothetical proteins from C. trachomatis.

Pfam Summary:  Pfam Search
Residues 431 to 835 (E-value = 1.3e-212) place CT620 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
221  
256
non-globular  
265  
338
non-globular  
380  
509
coil-coil  
646  
692

PDB Hit:
None.

Gene Protein Sequence:
MCSMNIFNKINSVSKDYTKIEELFLPTHKNKTFCMNQVMQFQKTEIERSA
IQNVLSLLDLDNDVKGKYEQLVASLSSSAPTTTSQPSDESAVITYDPPSS
NPLYNASKQAWVHNVLVGFLSVVNEAKTKATEIAGQQNPPQTDLKPLTDL
FDSLTTLVDKANHRELSNEDLETFYLLPDQIFSAIQTFPFEGNQKVLFSN
QLLDSFGEDSSVEQIFADIRIEGLQDTLNMVQSKLSATEFESFKELQMII
DTLREYVEPFNDEGFDTILQTSKDLSSAIINSSLSSNDKIELCRNIADLY
RDQVLSIKNLDNVLNETIYINARNSSLFSNICSLVEFIMGSFAPIGLNET
TIEVTNASIAGALQAVRAIDTRFHELTPEQKNLVNETVKKLDDFSGGNYI
GAVWAYFTSATVISSKDSVTTDEVKQALTSQANTIVSDFSLAQTLKSTIN
KIVQENGKFKATVDGIERQYTIFGPPENDTSSNKATLNLILLNFGSIGFL
PNITLAANNHAETSARAFFKFRALAQVESTKLDGTLQGSENFLQKINQLR
TDLFSYQLLAQSYEIRSLPLPSAVASVLIDRYMPQEIDYLTQMKSDLYYS
NFGSSVGNAMIEAIAQFVNGATYFNFASFAGQQPMTAMAQDTFPGSKETA
ETKLALEKQQAKLYLQYATQALKVVQEQMERVQNDKVITNEQRLRITDAL
KGYADNLNAISGSLVLLQVYLNPLSVGVRDGNQGGNDTGTDPKGTFHVFG
GQDQWQARLEILEDALVSGLPSNIISGGLFPVQASVQSDQQAYADMGQNY
QLEMQMHMTAMQQEWTVVATSLQILNQIYLGLTRKLAG

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTTCTATGAACATATTTAATAAAATTAACTCTGTTTCAAAAGATTA
CACAAAAATAGAAGAATTATTTCTTCCTACGCATAAGAATAAAACTTTCT
GCATGAATCAAGTAATGCAGTTTCAAAAAACAGAAATAGAGCGTAGCGCT
ATTCAGAATGTTCTATCTCTTTTAGATTTAGATAATGATGTGAAAGGGAA
ATACGAACAGTTAGTTGCTTCCCTATCTTCTAGCGCTCCAACGACCACGT
CTCAGCCTTCAGATGAATCAGCTGTAATCACATACGATCCACCCTCTTCT
AATCCTCTGTATAACGCTTCGAAACAAGCCTGGGTACACAATGTATTGGT
TGGCTTTCTCTCTGTCGTAAACGAAGCTAAAACAAAAGCTACGGAAATCG
CTGGGCAACAAAATCCTCCACAAACAGACCTTAAGCCTCTGACAGATTTA
TTTGATTCGTTAACTACTCTAGTAGATAAGGCTAATCACAGAGAACTATC
TAACGAAGACTTAGAGACATTTTATCTCCTTCCTGACCAGATCTTTTCTG
CTATTCAAACTTTCCCATTTGAAGGAAATCAAAAAGTACTCTTTTCCAAT
CAATTATTGGATTCTTTCGGAGAAGATAGCTCTGTAGAACAGATATTTGC
AGACATACGAATTGAAGGACTTCAAGATACCCTGAACATGGTCCAATCAA
AACTGTCTGCTACAGAATTCGAATCCTTTAAAGAATTACAGATGATCATA
GATACTCTCCGTGAGTATGTTGAACCGTTCAATGACGAAGGATTTGATAC
CATTTTACAGACGAGTAAAGATCTATCTTCTGCTATCATCAATTCTTCTC
TCTCCAGCAACGATAAGATAGAACTCTGCCGTAATATTGCCGATCTTTAC
AGAGACCAAGTGTTATCTATCAAAAACTTAGATAATGTATTGAATGAGAC
CATTTATATAAACGCTCGCAACAGCTCTCTGTTCTCAAACATTTGCAGTC
TCGTTGAATTCATCATGGGGAGTTTCGCTCCTATCGGACTAAATGAGACT
ACTATAGAGGTAACGAACGCATCAATTGCTGGAGCCCTGCAAGCAGTGCG
CGCCATTGACACTCGTTTCCATGAACTAACTCCTGAACAGAAAAATCTCG
TCAATGAAACGGTCAAGAAACTTGATGACTTCTCAGGAGGTAACTACATC
GGTGCCGTTTGGGCTTACTTTACGTCTGCAACAGTCATCTCCTCTAAAGA
CTCTGTGACGACAGATGAAGTCAAACAAGCGTTAACCTCGCAAGCTAATA
CTATCGTCTCGGATTTTTCCTTAGCCCAAACGTTAAAATCTACGATTAAT
AAAATTGTACAAGAAAACGGGAAATTTAAAGCTACGGTTGATGGTATAGA
GCGACAATATACTATTTTCGGCCCGCCTGAAAACGATACAAGTTCTAACA
AAGCCACTCTTAACCTAATCCTTCTTAACTTTGGATCTATAGGATTCTTG
CCCAACATTACTTTGGCAGCGAATAACCATGCAGAGACTTCCGCTAGAGC
CTTTTTTAAATTTAGAGCTCTAGCACAGGTAGAAAGTACAAAACTAGATG
GAACCTTACAAGGAAGTGAGAACTTCTTACAGAAGATAAATCAATTACGA
ACAGACCTTTTTTCCTACCAACTCCTTGCACAATCCTATGAAATTCGCTC
TCTTCCCCTTCCTTCTGCAGTTGCTTCGGTCCTTATAGATCGCTACATGC
CTCAAGAGATTGATTACTTAACACAGATGAAATCGGATCTGTATTACAGT
AACTTCGGCTCTAGTGTTGGAAATGCTATGATTGAAGCTATTGCTCAATT
CGTGAATGGAGCTACCTACTTCAATTTTGCGAGCTTTGCTGGACAACAAC
CTATGACAGCTATGGCTCAGGATACCTTCCCTGGCTCTAAAGAGACAGCT
GAAACAAAACTCGCTTTAGAAAAACAACAAGCTAAACTCTACCTGCAATA
CGCTACTCAAGCTCTAAAGGTAGTCCAAGAACAGATGGAACGAGTCCAAA
ACGATAAGGTTATCACTAACGAACAGAGATTACGCATCACAGATGCTTTA
AAAGGATACGCAGACAACCTCAACGCCATTAGCGGTTCTTTAGTCTTATT
ACAGGTATACCTGAATCCTCTCAGCGTGGGAGTTCGTGATGGCAACCAGG
GAGGCAACGATACAGGAACAGACCCTAAAGGAACTTTCCACGTGTTCGGA
GGACAAGATCAGTGGCAAGCACGTTTAGAAATTCTAGAAGATGCTCTTGT
CTCAGGACTTCCTTCTAATATCATCAGCGGAGGACTGTTCCCCGTACAAG
CAAGTGTGCAATCTGACCAACAAGCCTATGCAGATATGGGGCAGAACTAC
CAACTGGAAATGCAAATGCATATGACGGCCATGCAGCAAGAATGGACGGT
AGTAGCCACATCTTTACAAATTCTTAACCAAATCTATCTTGGTTTAACAA
GAAAACTGGCTGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy