Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR508 IGR510 IGR509 IGR505 IGR507 IGR506 CT616 rpoD, - CT615 CT621 CT619 rs20, - CT617 CT618 CT620 CT616 rpoD, - CT615 CT621 CT619 rs20, - CT617 CT618 CT620 CT616 rpoD, - CT615 CT621 CT619 rs20, - CT617 CT618 CT620
* Calculated from Protein Sequence

Gene ID: CT619

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein (acidic)

Gene Start:
701659

Gene Stop:
699029

Gene Length:
2631

Molecular Weight*:
97041

pI*:
4.64

Net Charge*:
-32.02

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT619 is similar to CPn0727: residues 1-877 of CT619 are 38% similar to residues 1-872 of CPn0727, a predicted Chlamydia-specific protein from C. pneumoniae. CT619 is also similar to CPn0852, CPn0853, CPn0726, all hypothetical proteins from C. pneumoniae. No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
This protein is paralogously related to 4 other hypothetical proteins.
Residues 607-872 are 26% similar to CT712, residues 431-870 are 23%
similar to CT711, residues 610-874 are 23% similar to CT621,
and residues 471-874 are 22% similar to CT620.

Pfam Summary:  Pfam Search
Residues 488 to 873 (E-value = 4.3e-195) place CT619 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
174  
217
coil-coil  
347  
402
coil-coil  
549  
580
non-globular  
611  
685
non-globular  
795  
877

PDB Hit:
None.

Gene Protein Sequence:
MSSYYLNFRPTTVSGEGLFKIKLANPGSDFKNQARPAIDMEELNSGLYVL
RRLAVALEAGYLGVGSVVNPSNRIFPGGDWGVRRAAGGRTPAAGIISGST
IADIKQSTAKVLVTTITDSLNALIEDVPELPMTQVAGISSTLVLMATYQQ
KPSLDETDQKAIFGSAYIPADTSIKDVIKKEQEKELQEGKDRITAQLTAQ
GASNQVIEKSLADYEKYYVNEYFDTHVKEALWKHRASIGENIQEMLDQCL
VLGLDVPDSLTKENINDANAKLVLQAWMEAFNNAMEVEPALGGSKEVIDS
VLKMIPFAKPDANLSAEDISSIYTQAALPSPEVMDYYLTRQDAGVCKGEV
VKAFQQATQNLQSVRSNVEEQIKELEVKKTSFLQAQASLESMLEGVKRLS
DNKDFTSVRLTSVMECYAGLMALSQIAGVLEDEGLTLITKYVNQFLQLNN
ANTDQTLAHVISYMVAYCEVAESTMASTISDENTVIQKVRNKWTELTKQK
FFSSFNSTMPSEEELKKNYITNKNSVYQANFGNFVDNVITRNLNLSDAVT
KAQSMLTEFQGKATEYLSKFQQEINELNRTYDTLDPAKASFNTSTGSTPS
LRAQAVDSWIDSTSLGSAFIHLILNTQIPKQENFLNPLIQEVNFNNVAAN
AVNDLLSITNNFSTSSVYYNLSSYLVESKEGENLFCGDFFEFIGALAKEH
EYIVRDINSCYRAEAFGEALLARVEALAQGHKVTDAQANSMRTQANLYLS
FIRIIVEQLAVLDSLLRSLNYEVEKKDNNYDKDKYKITGPTDWISTLASL
EGYAANGFDNASPSGGLGPMHTLVQTDQHDYLTQSQTQQLNLQNQMTNIQ
QEWTLVSTSMQVLNGILSHLAAEIYSN

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCTTACTATTTAAATTTTAGGCCAACTACTGTATCTGGAGAGGG
TTTATTTAAGATTAAACTCGCCAATCCTGGCTCAGATTTTAAAAACCAAG
CACGGCCAGCCATTGATATGGAGGAGTTAAACTCAGGACTTTATGTACTA
AGACGTTTAGCTGTAGCTTTGGAAGCTGGATATTTGGGAGTTGGTTCTGT
GGTCAATCCCTCTAACAGAATATTTCCTGGAGGAGACTGGGGGGTAAGAA
GAGCCGCAGGAGGCAGAACTCCGGCAGCAGGTATTATTTCTGGTAGTACT
ATTGCAGATATTAAGCAAAGTACCGCTAAAGTATTAGTGACTACCATTAC
AGATAGTTTGAATGCTCTGATAGAAGACGTGCCAGAGTTACCTATGACTC
AAGTAGCTGGTATATCGTCGACTTTAGTTTTAATGGCTACCTACCAGCAA
AAACCCTCGCTTGATGAAACAGATCAGAAAGCTATTTTTGGTAGTGCATA
CATTCCTGCTGATACGTCCATTAAGGATGTCATTAAGAAAGAACAAGAAA
AAGAGCTTCAAGAAGGTAAAGATCGTATTACAGCTCAGTTAACAGCTCAA
GGTGCTTCTAATCAGGTCATAGAGAAGTCTTTGGCTGATTATGAGAAGTA
TTATGTTAATGAGTACTTTGATACGCATGTGAAGGAAGCTTTGTGGAAGC
ATCGAGCAAGCATAGGAGAAAATATCCAGGAGATGCTGGACCAGTGTTTG
GTTTTAGGCCTAGATGTTCCAGATTCTTTGACGAAAGAGAATATAAACGA
TGCTAACGCAAAGTTAGTGCTTCAAGCTTGGATGGAAGCTTTCAATAATG
CTATGGAGGTTGAACCCGCTTTAGGTGGATCTAAAGAAGTCATTGATTCT
GTGTTGAAAATGATTCCTTTTGCGAAGCCGGATGCTAATTTAAGCGCGGA
GGATATTAGTAGTATTTACACACAAGCTGCCTTACCTTCTCCAGAGGTGA
TGGATTACTATCTGACTAGACAAGATGCAGGAGTTTGTAAGGGAGAGGTG
GTTAAAGCCTTTCAGCAAGCAACGCAGAATCTCCAATCTGTACGTTCTAA
TGTAGAAGAGCAAATTAAAGAGTTAGAAGTTAAAAAGACATCCTTCTTAC
AAGCACAAGCGTCGTTAGAGAGTATGCTGGAAGGGGTAAAGCGTCTTAGC
GACAATAAAGATTTTACTTCAGTGCGCTTAACCTCTGTTATGGAGTGTTA
TGCAGGACTCATGGCACTCTCGCAAATAGCTGGAGTTTTGGAGGACGAGG
GACTCACTCTTATAACCAAATATGTGAATCAATTTTTACAACTCAATAAC
GCTAACACAGATCAAACGTTAGCACACGTTATATCCTACATGGTGGCCTA
TTGCGAGGTAGCTGAGAGCACAATGGCTAGTACGATTTCTGATGAGAATA
CAGTGATTCAAAAAGTTAGAAATAAATGGACAGAACTAACAAAACAAAAA
TTTTTTTCATCTTTTAATTCGACTATGCCTTCAGAAGAAGAATTGAAAAA
AAATTATATTACAAATAAAAACAGTGTTTATCAGGCAAACTTTGGTAATT
TTGTAGATAATGTAATTACGAGAAATTTAAATCTTTCGGATGCTGTTACT
AAAGCACAGTCAATGTTGACAGAATTTCAAGGGAAAGCTACAGAATACCT
GAGCAAATTCCAACAAGAGATAAATGAACTCAATCGGACTTACGACACAT
TAGATCCAGCTAAGGCTTCTTTTAATACTTCTACAGGGAGTACACCTTCT
TTACGTGCACAGGCTGTAGATAGCTGGATCGACTCTACGAGTTTAGGTTC
TGCTTTTATCCATCTCATTTTAAATACACAAATTCCTAAGCAGGAGAATT
TCCTAAATCCTTTGATTCAAGAAGTGAACTTCAACAATGTCGCTGCTAAC
GCTGTTAACGACCTCCTATCCATTACTAATAACTTCTCTACCTCATCCGT
TTACTACAATCTTTCTTCCTATCTTGTAGAAAGTAAGGAGGGAGAAAACT
TATTTTGTGGGGATTTCTTTGAGTTCATAGGGGCTTTAGCTAAGGAACAC
GAATATATCGTTAGGGATATTAATAGCTGTTATCGCGCCGAGGCTTTTGG
AGAAGCTTTACTAGCTAGAGTGGAAGCTTTAGCGCAAGGGCATAAAGTAA
CGGATGCACAAGCGAACAGCATGCGCACGCAAGCCAATCTGTATTTATCT
TTTATTCGTATTATCGTGGAGCAGTTAGCAGTTTTAGACTCTCTGTTAAG
AAGTCTTAATTATGAGGTTGAGAAGAAAGATAACAATTATGACAAGGATA
AATATAAGATAACTGGACCTACAGATTGGATTTCGACATTGGCAAGTTTA
GAAGGGTATGCAGCAAACGGATTTGATAATGCCAGTCCTTCAGGAGGATT
GGGGCCCATGCATACGCTAGTACAAACGGATCAGCACGATTATCTAACAC
AGAGCCAAACGCAACAATTAAACTTGCAAAACCAAATGACGAACATTCAA
CAGGAATGGACGTTAGTTTCTACCTCTATGCAAGTTCTCAATGGGATTTT
GTCTCATTTAGCAGCGGAAATTTACTCTAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy