Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR504 IGR508 IGR509 IGR505 IGR507 IGR506 folX, - CT614 CT616 folP, - CT613 rpoD, - CT615 CT619 rs20, - CT617 CT618 CT620 folX, - CT614 CT616 folP, - CT613 rpoD, - CT615 CT619 rs20, - CT617 CT618 CT620 CT616 folP, - CT613 rpoD, - CT615 CT619 folX, - CT614 rs20, - CT617 CT618 CT620
* Calculated from Protein Sequence

Gene ID: CT618

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
698170

Gene Stop:
698967

Gene Length:
798

Molecular Weight*:
27921

pI*:
8.98

Net Charge*:
5.23

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
103
transmembrane  
154  
170
transmembrane  
215  
238
transmembrane  
242  
265

PDB Hit:
None.

Gene Protein Sequence:
MAATVPIASSVGRLLSSATATTLRGNATSLRSKLNSVDDFFDLISSSCTL
ARVAPGTTVSETQQQQLSTIETTLDSARSASNAVQAGCGIVQLLTGGLFF
KTNPDGSFQLDPVSQQRTLLSPLSLLSKVTRLASKVLGTVKFMGSQAFPV
YQLGAHATGIGLSASAFGTVSSAFDVAENSREVLGNLKQNKPTEGTSKEN
GFMARLKRARASMFNLLCSIFDLLAQAFCFISDAVSTAFMGVHTAFIVGI
FCFLSALGNVILSFAF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCAACGGTACCCATAGCAAGCTCAGTGGGCAGACTACTATCTTC
CGCAACCGCAACTACTTTGCGAGGCAACGCAACATCCCTTCGCTCAAAGC
TCAACTCTGTTGATGATTTTTTTGACCTCATATCCTCTTCCTGCACCTTA
GCAAGAGTAGCACCAGGGACCACTGTCTCTGAGACGCAACAACAGCAGCT
GTCCACTATAGAGACCACATTGGACTCGGCTCGAAGTGCAAGTAATGCTG
TTCAAGCAGGGTGTGGAATTGTACAATTACTAACCGGTGGGTTATTCTTC
AAAACCAATCCTGATGGATCTTTCCAACTAGATCCTGTTTCGCAACAAAG
AACGCTCCTATCTCCACTATCACTTCTCAGCAAAGTAACTCGTTTAGCTA
GCAAAGTTCTTGGAACCGTGAAATTCATGGGCTCCCAAGCTTTCCCTGTT
TACCAGTTGGGTGCACACGCAACAGGTATTGGCTTATCTGCTTCTGCATT
TGGAACTGTCAGCTCCGCCTTCGATGTCGCAGAAAACTCAAGAGAAGTTC
TCGGGAACCTCAAACAGAACAAACCTACAGAAGGAACATCTAAAGAAAAC
GGCTTCATGGCACGTCTTAAAAGAGCTCGTGCAAGTATGTTCAACTTGCT
TTGCAGCATCTTTGACTTGCTGGCTCAGGCTTTCTGTTTTATCAGCGATG
CAGTTTCTACAGCATTTATGGGCGTGCATACCGCTTTTATTGTGGGTATC
TTCTGCTTCCTATCTGCTTTGGGAAATGTTATTCTTTCTTTCGCTTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy