Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR502 IGR504 IGR503 IGR505 IGR507 IGR506 folX, - CT614 CT610 CT611 CT616 folP, - CT613 rpoD, - CT615 rs20, - CT617 CT618 rpoN, - CT609 uvrD, - CT608 folX, - CT614 CT610 CT611 CT616 folP, - CT613 rpoD, - CT615 rs20, - CT617 CT618 rpoN, - CT609 uvrD, - CT608 folX, - CT614 CT610 CT611 CT616 folP, - CT613 rpoD, - CT615 folA, - CT612 folA, - CT612 rs20, - CT617 CT618 rpoN, - CT609 uvrD, - CT608
* Calculated from Protein Sequence

Gene ID: CT614

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folX  

Definition:
probable dihydroneopterin aldolase (DHNA)

Gene Start:
694020

Gene Stop:
693649

Gene Length:
372

Molecular Weight*:
13892

pI*:
5.06

Net Charge*:
-2.90

EC:
4.1.2.25  

Functional Class:
cofactor biosynthesis; folate  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis

Comment:
The DHNA enzyme is involved in folate biosynthesis. See
CT612, CT613 and CT078.

Blast Summary:  PSI-Blast Search
Sole hit in gapped BLAST to Dihydroneopterin aldolase sequences,
e.g. residues 1-121 are 31% similar to FOLB_METEX. No similarities to T.pallidum
or M.genitalium.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1539
COG name: Dihydroneopterin aldolase
Functional Class:  H
The phylogenetic pattern of COG1539 is ----y--cEbrhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 7-18 are matched to block PR00549D, concerned with
Hyperglycemic hormone type 2 signature sequences,e.g. S48747.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 121 (E-value = 4.2e-47) place CT614 in the FolB family which is described as Dihydroneopterin aldolase (PF02152)

PDB Hit:
none

Gene Protein Sequence:
MLLYRLDIADFRVWVSIGVSEQERHYPQPVLVSLSLFFKEEPKACSTDKV
SDSVCYAELVSLIEEVATNNPCALIERLAKVLLEKIEKALAGQVSRIDLR
VSKERPPIPDLLSPVSFSISREVP

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTGTTGTATCGTTTAGATATAGCGGATTTTCGCGTTTGGGTATCTAT
AGGAGTCTCAGAACAAGAACGGCATTATCCGCAGCCCGTTCTTGTTTCTT
TATCTCTTTTTTTTAAAGAAGAGCCAAAGGCTTGTTCCACGGACAAAGTC
TCTGATAGCGTGTGTTATGCAGAGCTTGTTTCTCTTATTGAAGAAGTTGC
AACGAATAATCCTTGTGCTTTAATTGAACGTTTAGCTAAGGTTTTGCTGG
AAAAAATAGAAAAGGCTTTGGCTGGACAAGTTTCTAGGATTGACTTGCGA
GTAAGTAAAGAGCGTCCTCCGATCCCAGATCTACTCAGTCCTGTAAGTTT
CAGCATAAGTAGAGAGGTGCCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy