Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR502 IGR504 IGR501 IGR503 IGR505 folX, - CT614 CT610 CT611 CT616 folP, - CT613 rpoD, - CT615 rpoN, - CT609 uvrD, - CT608 folX, - CT614 CT610 CT611 CT616 folP, - CT613 rpoD, - CT615 rpoN, - CT609 uvrD, - CT608 folX, - CT614 CT610 CT611 CT616 folP, - CT613 rpoD, - CT615 folA, - CT612 folA, - CT612 rpoN, - CT609 uvrD, - CT608
* Calculated from Protein Sequence

Gene ID: CT612

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folA  

Definition:
dihydrofolate reductase

Gene Start:
692300

Gene Stop:
691824

Gene Length:
477

Molecular Weight*:
18365

pI*:
7.42

Net Charge*:
1.01

EC:
1.5.1.3  

Functional Class:
central intermediary metabolism; one carbon metabolism  
cofactor biosynthesis; folate  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis

Comment:
From Prosite PDOC00072.

Dihydrofolate reductases are ubiquitous enzymes which catalyze the reduction of folic acid into tetrahydrofolic acid. They can be inhibited by a number of antagonists such as trimethroprim and methotrexate, which are used as antibacterial or anticancerous agents.

See CT613, CT614, and CT078.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to dihydrofolate reductase sequences,
e.g. residues 7-128 are 34% similar to S.pneumoniae(Z84379). CT612 is
similar to MG228, a predicted dihydrofolate reductase in M.genitalium. No
similarity to T.pallidum.

CT0612 is orthologously related to CPn0759: residues 6-159 are 52%
similar to CPn0759.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0262
COG name: Dihydrofolate reductase
Functional Class:  H
The phylogenetic pattern of COG0262 is ----y-v-eBrh--GP--in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 7-37, 33-63, 32-62, 85-115, 42-53, 55-67, 91-100 are matched
to blocks BL00075A,B,C,D, concerned with Dihydrofolate reductase
protein sequences, e.g. in DYR_NEIGO.

ProDom Summary:  Protein Domain Search
Residues 41-100 are 40% similar to a dihydrofolate reductase type I domain
as seen in DYR_NEIGO.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 153 (E-value = 1.1e-15) place CT612 in the DiHfolate_red family which is described as Dihydrofolate reductase (PF00186)

PDB Hit:
gi|1311369|pdb|1DDS|A Chain A, Molecule: Dihydrofolate Reductase (E.C.1.5.1.3) Complexed With Methotrexate Mol_id: 1; Molecule: Dihydrofolate Reductase; Chain: A, B; Ec: 1.5.1.3; Heterogen: Methotrexate; Heterogen: Chloride Ion; Heterogen: Calcium Ion

Gene Protein Sequence:
MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWE
SLPDKYKHGRDIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELF
ESFFQQNLLKACFVTHIKKEYWGDTFFPITRLSGWKKECICNTEDFSIYY
YENNSDQNT

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCCAAGCAACAGGTATCGTTGCTATTGATCCCAGAGGAGTGATGGG
AGCTTTAGGCAAGCTCCCTTGGAGTTATCCCGAAGATCTACGTTTTTTTG
CAGAAACCATTCGAAATCATCCCATCATTATGGGACGAAAGACTTGGGAG
TCTCTTCCAGACAAGTATAAGCATGGGCGGGATATCGTTGTCTTTTCTCG
CAGGATGCATCCACCACAATGCATAGGAGTTTCTTCCTTTGCAGAGTATG
GGACACTATCTTTGAATCATCCGTTTTTAATTGGGGGAGCGGAGCTCTTT
GAAAGTTTTTTCCAACAAAACCTTCTGAAAGCTTGTTTTGTCACACATAT
CAAAAAGGAATATTGGGGCGATACTTTCTTCCCTATCACGCGATTATCAG
GATGGAAGAAGGAATGTATTTGTAATACAGAGGATTTCAGTATTTATTAT
TATGAAAATAACTCCGATCAAAACACG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy