Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR502 IGR498 IGR501 IGR503 IGR499 ung, - CT607 CT610 CT611 CT605 folP, - CT613 groEL, - CT604 CT606 rpoN, - CT609 uvrD, - CT608 ung, - CT607 CT610 CT611 CT605 folP, - CT613 groEL, - CT604 CT606 rpoN, - CT609 uvrD, - CT608 ung, - CT607 CT610 CT611 CT605 folP, - CT613 groEL, - CT604 CT606.1 folA, - CT612 folA, - CT612 CT606.1 CT606 rpoN, - CT609 uvrD, - CT608
* Calculated from Protein Sequence

Gene ID: CT608

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uvrD  

Definition:
ATP dependent DNA helicase

Gene Start:
687100

Gene Stop:
689001

Gene Length:
1902

Molecular Weight*:
72718

pI*:
6.41

Net Charge*:
-5.03

EC:
3.6.1.-  

Functional Class:
DNA replication and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis

Comment:
In E.Coli this helicase is also involved in postincision events of nucleotide
excision repair and methyl directed mismatch repair.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA helicase sequences, e.g. residues 2-632 are 44%
similar to the PcrA protein of B.subtilis (Y15254), which is similar to
a DNA helicase (Z99107). CT608 is similar to TP0102, TP1028, and TP0898 in T.pallidum, all
DNA-dependent ATPases, helicases and nucleases. It is also similar to a
helicase II in M.genitalium, MG244.

CT608 is orthologously related to CPn0772: residues 4-628 are 62% similar to residues 5-632 of CPn0772.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0210
COG name: Superfamily I DNA and RNA helicases
Functional Class:  L
The phylogenetic pattern of COG0210 is --T-YqvCEBRHUJgPOLinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 2-395 are 43% similar to an exonuclease domain observed in PCRA_STAAU.
Residues 397-536 and 546-632 support this association as evidenced by
further similarites to PCRA_STAAU.

Paralogs:  Local Blast Search
CT608 is weakly paralogous to CT639, a predicted exodeoxyribonuclease V beta sequence:
residues 166-602 are 23% similar to CT608.

Pfam Summary:  Pfam Search
Residues 6 to 486 (E-value = 8e-221) place CT608 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

PDB Hit:
gi|2781090|pdb|1PJR| Structure Of Dna Helicase Dna Repair, Dna Replication, Sos Response, Helicase, Atp-Binding, Dna-Binding Mol_id: 1; Molecule: Pcra; Chain: Null; Engineered: Yes

Gene Protein Sequence:
MLTSELNAAQVTAVTAPLQPVLVLAGAGAGKTRVVTHRILYLIEESRLDP
KQILAITFTNKAANELKERVQSQCRELGYSDVPMVSTFHSLSVYILRRSI
HLLDRQSNFVIYDQSDSEKLIKQCLRKLNLDKKLCNAMQFTISQAKNRLQ
SPEDLDSKEYPDPTRTVYAEYQEQLRAANALDFDDLLFLTEKLLRTPEVQ
QEYANHWKALLIDEYQDTNHAQYLIAKRLAAAHNNIFVVGDPDQSIYSWR
GANISNILNFEQDYSQALVVRLEENYRSCGTILEAANALIQNNSARLEKT
LRSVKGPGDKIFCFTGKNDRDEAEQVLEEISNLHSYKDIPLSDICILYRT
NFQSQSFEAALLKRGYPYEIIGGISFYKRREIQDILAFLRLFSNNYDMAA
FERTISLKKCGIGATTLAALMNYAKTTDLPILQACWDVLEKKSIRLTKKQ
QQGLFSYLTHFHQMEQLYGNCDLHEFINETIRITDYLSILKEDPETYEDR
KNNLEQLLAETQTWGKSSENLPGFLEDLALKSSADETASSHDRLKLMTIH
NSKGLEFPVVFLVGLEENLLPHANSKGMHENIEEERRLCYVGITRAQEYL
YLSRAKTRFLWGTERTMVPSRFISELPRALLKFV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTACATCCGAATTAAATGCAGCACAAGTTACTGCCGTCACGGCGCC
ACTACAACCAGTCCTGGTCTTAGCTGGAGCTGGAGCAGGGAAAACTCGAG
TAGTCACTCATCGAATCCTTTATTTAATAGAAGAATCCCGGCTCGATCCT
AAACAAATTTTAGCTATTACGTTCACGAACAAAGCAGCTAACGAACTAAA
AGAACGTGTCCAATCGCAATGTCGTGAGCTAGGATATTCAGACGTACCTA
TGGTAAGCACATTCCATAGTCTTAGCGTTTATATCCTGCGACGCTCTATT
CATTTGTTAGATAGACAGTCGAATTTTGTTATTTATGATCAGAGTGATTC
TGAAAAATTAATTAAGCAATGCTTACGCAAGCTGAACCTCGATAAAAAGC
TTTGCAATGCAATGCAATTTACTATCTCTCAAGCAAAAAATCGCTTGCAG
AGTCCTGAAGATCTCGATTCCAAAGAATATCCAGACCCTACTCGCACCGT
TTATGCTGAATACCAAGAACAGTTACGTGCTGCGAACGCTCTAGATTTCG
ATGATCTGTTATTCCTAACAGAAAAACTGTTGCGCACACCTGAAGTCCAG
CAAGAATACGCTAATCATTGGAAAGCCTTGTTGATAGATGAGTATCAAGA
CACCAACCACGCGCAATATCTCATTGCCAAACGTCTTGCTGCGGCTCATA
ACAATATCTTTGTCGTTGGAGATCCCGACCAATCTATATATTCTTGGAGA
GGCGCCAACATCTCTAATATCTTAAACTTTGAGCAAGATTATTCGCAGGC
TTTAGTTGTTCGCTTAGAAGAAAACTATCGTTCTTGTGGGACCATCCTAG
AAGCCGCTAATGCTCTGATTCAAAATAATTCTGCACGCTTAGAAAAAACA
TTGCGTAGTGTAAAAGGGCCTGGAGATAAAATTTTCTGTTTTACAGGGAA
AAATGACCGCGATGAGGCAGAGCAAGTCTTAGAGGAAATCTCTAATCTTC
ATTCCTATAAAGATATCCCTCTCTCTGACATTTGTATTTTATATCGAACG
AACTTTCAGTCTCAATCGTTCGAAGCGGCTCTTCTTAAGCGAGGTTATCC
CTATGAAATTATAGGTGGCATTTCCTTCTACAAGCGTAGAGAAATCCAAG
ATATTCTTGCTTTCCTTCGCTTATTTTCTAATAACTACGACATGGCAGCC
TTTGAGCGAACCATTAGCCTGAAAAAATGCGGTATTGGAGCTACCACATT
AGCCGCTCTTATGAACTATGCCAAAACAACAGACCTACCTATATTGCAGG
CTTGTTGGGACGTATTAGAGAAAAAATCTATCCGTTTAACTAAAAAACAA
CAGCAAGGGCTTTTCTCTTATTTGACTCATTTCCATCAAATGGAGCAGCT
ATACGGAAACTGCGATCTTCATGAATTCATCAATGAAACGATCCGCATCA
CGGATTACCTCTCCATCCTCAAAGAAGATCCTGAAACCTATGAAGATAGA
AAAAACAACTTAGAGCAATTATTAGCAGAAACGCAAACATGGGGTAAAAG
CAGTGAAAACTTGCCTGGTTTCCTAGAAGATCTAGCTCTAAAAAGTTCCG
CAGATGAAACAGCAAGTTCCCATGATCGCCTCAAGCTCATGACGATCCAT
AACAGTAAAGGGTTAGAGTTTCCTGTAGTCTTTCTGGTAGGTCTTGAAGA
AAACCTTCTTCCTCATGCCAACTCGAAAGGTATGCATGAAAATATTGAAG
AGGAACGGAGATTGTGTTACGTGGGAATTACCCGAGCACAAGAGTATCTC
TATTTATCTCGAGCAAAAACCCGATTCCTTTGGGGAACGGAACGCACCAT
GGTCCCCAGCAGATTTATTAGCGAGCTTCCGAGGGCTCTTTTAAAATTTG
TT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy