Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-2 IGR502 IGR498 IGR501 IGR503 IGR499 IGR497 ahpC, - CT603 ung, - CT607 CT610 CT611 CT605 groEL, - CT604 CT606 rpoN, - CT609 uvrD, - CT608 ahpC, - CT603 ung, - CT607 CT610 CT611 CT605 groEL, - CT604 CT606 rpoN, - CT609 uvrD, - CT608 ahpC, - CT603 ung, - CT607 CT610 CT611 CT605 groEL, - CT604 CT606.1 CT606.1 CT606 rpoN, - CT609 uvrD, - CT608
* Calculated from Protein Sequence

Gene ID: CT607

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ung  

Definition:
Uracil-DNA N-glycosylase

Gene Start:
687019

Gene Stop:
686333

Gene Length:
687

Molecular Weight*:
25987

pI*:
8.64

Net Charge*:
6.40

EC:
3.2.2.-  

Functional Class:
DNA replication and repair  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
The sequence of uracil-DNA glycosylase (monomer)is extremely well conserved in bacteria and eukaryotes as well as in herpes viruses. The enzyme removes unwanted uracil from DNA (misincorporated dUTP).

From Prosite PDOC00121:

Uracil-DNA glycosylase (EC 3.2.2.-) (UNG) is a DNA repair enzyme that excises uracil residues from DNA by cleaving the N-glycosylic bond. Uracil in DNA can arise as a result of misincorportation of dUMP residues by DNA polymerase or deamination of cytosine.

The sequence of uracil-DNA glycosylase is extremely well conserved in bacteria and eukaryotes as well as in herpes viruses. More distantly related uracil-DNA glycosylases are also found in poxviruses.

In eukaryotic cells, UNG activity is found in both the nucleus and the mitochondria. Human UNG1 protein is transported to both the mitochondria and the nucleus. The N-terminal 77 amino acids of UNG1 seem to be required for mitochondrial localization, but the presence of a mitochondrial transit peptide has not been directly demonstrated.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to Uracil-DNA glycosylase proteins,
e.g. residues 10-229 are 52% similar to UNG_BACSU. CT607 is similar to
the predicted uracil DNA glycosylase of B.burgdorferi (AE001118) and to
MG097 of M.genitalium. No similarity to T.pallidum.

CT607 is orthologously related to CPn0773:
residues 8-228 are 77% similar to residues
15-235 of CPn0773.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0692
COG name: Uracil DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG0692 is ----y---ebrhujgpo-in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 63-73, 92-102, 44-54, 118-145, 162-175, 188-198, 203-226 are
matched to blocks BL00130A,B,C,D,E,F, concerned with Uracil-DNA
glycosylase protein sequences, e.g. UNG_ECOLI.
Residues 214-225 are matched to block PR00623F,concerned
with Histone H4 signature sequences.

ProDom Summary:  Protein Domain Search
Residues 25-215 are 55% similar to a Uracil-DNA glycosylase precursor,
represented by UNG_HAEIN.
Residues 20-226 are 28% similar to a Uracil-DNA glycosylase domain,
represented by UNG_VACCV.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 57 to 217 (E-value = 3.9e-76) place CT607 in the UDG family which is described as Uracil DNA glycosylase superfamily (PF03167)

PDB Hit:
gi|2392165|pdb|1AKZ| Human Uracil-Dna Glycosylase Glycosylase, Dna Repair, Uracil Removal From Dna, Alpha Beta Protein, Glycosidase Mol_id: 1; Molecule: Uracil-Dna Glycosylase; Chain: Null; Synonym: Udg, Ung; Ec: 3.2.2.-; Engineered: Yes; Mutation: P82m,

Gene Protein Sequence:
MHEAFTIEQLPPSWQEQLKDEWSQPYWSQLLAFLKSEYAQATIYPKKENV
FAALQSTPFDQVRVVILGQDPYHGEGQAHGLSFSVPRGQALPPSLRNIFQ
ELHTDLGIRNESGCLQAWADQGVLLLNTVLTVRAGEAFSHAGRGWERFTD
AIVTKLIQNRTHVIFVLWGNAARQKCNLLFQTKHQHAVLACPHPSPLAAH
RGFFGCCHFSKINYLLKKQGKTMINWKIE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACGAGGCTTTTACTATAGAGCAACTCCCCCCGTCTTGGCAAGAACA
GCTTAAAGATGAATGGTCTCAGCCTTATTGGTCCCAGTTGCTTGCTTTTT
TAAAAAGTGAATACGCACAAGCAACGATCTACCCTAAAAAAGAAAATGTT
TTTGCAGCTTTGCAGAGTACTCCTTTCGATCAAGTGCGGGTAGTGATTCT
TGGACAAGATCCGTATCATGGAGAAGGGCAGGCGCACGGCTTGAGTTTTA
GTGTTCCTAGAGGGCAGGCATTACCTCCATCTTTGCGTAATATTTTTCAG
GAACTCCATACCGATTTAGGGATTCGTAATGAATCTGGGTGTTTGCAAGC
CTGGGCAGATCAAGGTGTTCTTCTTTTGAACACCGTGCTCACAGTTCGCG
CAGGGGAAGCCTTCTCTCATGCAGGACGAGGATGGGAACGTTTTACCGAT
GCTATTGTGACTAAATTAATTCAAAATAGAACGCACGTAATCTTTGTTTT
ATGGGGGAATGCTGCGCGGCAAAAATGTAATCTGCTTTTCCAGACTAAGC
ATCAACATGCGGTTCTTGCTTGCCCGCATCCGTCTCCACTGGCTGCACAT
AGAGGGTTCTTTGGGTGTTGCCACTTTTCAAAAATTAATTATCTGCTTAA
AAAACAGGGAAAGACGATGATTAATTGGAAGATAGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy