Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR493 IGR491 IGR488 IGR492 IGR489 CT593.1 sdhC, - CT593 sdhB, - CT591 CT594 sdhA, - CT592 dsbD,dipZ, - CT595 CT590 tolR,exbD, - CT597 tolQ,exbB, - CT596 CT598 CT593.1 sdhC, - CT593 sdhB, - CT591 CT594 sdhA, - CT592 dsbD,dipZ, - CT595 CT590 tolR,exbD, - CT597 tolQ,exbB, - CT596 CT598 sdhC, - CT593 sdhB, - CT591 CT594 sdhA, - CT592 dsbD,dipZ, - CT595 CT590 CT593.1 tolQ,exbB, - CT596 CT598 tolR,exbD, - CT597
* Calculated from Protein Sequence

Gene ID: CT593

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdhC  

Definition:
Succinate dehydrogenase cytochrome component

Gene Start:
673334

Gene Stop:
672768

Gene Length:
567

Molecular Weight*:
21633

pI*:
10.10

Net Charge*:
6.80

EC:
1.3.99.1  

Functional Class:
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)
Energy Metabolism; Oxidative phosphorylation

Comment:
Succinate dehydrogenase in B.subtilis is a trimer consisting of a flavoprotein,
an iron-sulfur protein, and a cytochrome B-558. CT591 is the iron-sulfur
subunit. CT592 is the flavoprotein subunit. The enzyme converts succinate to fumarate in a reduction reaction.


Blast Summary:  PSI-Blast Search
Hits in gapped blast to sequences of succinate dehydrogenase protein,
e.g. residues 128-178 are 37% similar to Paenibacillus macerans(Y08563).
No similarities to T.pallidum or M.genitalium.

CT593 is orthologously related to CPn0788:
residues 4-187 are 50% similar to residues 110-294 of CPn0788.


COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 119-184, 7-35 are 30% and 41% similar to a domain from DHSC_BACSU,
concerned with succinate dehydrogenase cytochrome B-558 subunit.
Residues 123-176 are 25% similar to a domain from C560_CHOCR,
concerned with succinate dehydrogenase cytochrome B-560 subunit domain(subunit III).

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
47
transmembrane  
118  
139
transmembrane  
143  
159
transmembrane  
163  
186

PDB Hit:
none

Gene Protein Sequence:
MEEHLRYGRNLAYTLQRMTAWILLAGLAFHVIQFRFVLYPIQVTIQGKTF
YAVSFDAARYPSVVQGITGFFIMNVPFAEGGPQITEQFLQEKDRALFASH
KSYIFTPEAGKAFLYAVRNALGSLWMAIFYTLFVIAAVFHGFNGVWTFVS
RWGIIISSRYLRLCQILCYVGMCVVMAMGISVIWNMYLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGAACACCTACGTTACGGGAGGAATCTGGCATATACTCTACAGAG
AATGACGGCATGGATTTTATTAGCCGGGCTGGCTTTTCATGTAATCCAGT
TTCGATTTGTCTTGTATCCTATTCAGGTTACAATCCAAGGAAAGACTTTT
TATGCTGTTTCTTTTGATGCGGCTCGATATCCCTCTGTTGTACAGGGAAT
AACAGGCTTCTTCATTATGAATGTTCCATTTGCTGAGGGAGGACCTCAAA
TTACGGAGCAGTTTTTACAAGAAAAAGACCGAGCTTTATTTGCATCACAC
AAGTCGTACATTTTTACTCCAGAAGCAGGGAAAGCTTTTCTCTATGCAGT
AAGAAATGCTCTAGGATCTTTATGGATGGCAATTTTCTATACGCTTTTTG
TTATAGCTGCTGTTTTCCATGGGTTTAATGGAGTATGGACGTTTGTCTCG
CGATGGGGAATCATTATCTCTTCGCGCTATCTCCGATTATGTCAGATCTT
ATGTTACGTAGGGATGTGTGTTGTGATGGCTATGGGTATCAGCGTAATTT
GGAATATGTATTTGTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy