Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR487 IGR491 IGR488 IGR489 CT593.1 sdhC, - CT593 sdhB, - CT591 CT594 sdhA, - CT592 dsbD,dipZ, - CT595 CT590 CT589 CT593.1 sdhC, - CT593 sdhB, - CT591 CT594 sdhA, - CT592 dsbD,dipZ, - CT595 CT590 CT589 sdhC, - CT593 sdhB, - CT591 CT594 sdhA, - CT592 dsbD,dipZ, - CT595 CT590 CT593.1 CT589
* Calculated from Protein Sequence

Gene ID: CT591

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdhB  

Definition:
succinate dehydrogenase iron-sulfur subunit

Gene Start:
670810

Gene Stop:
670115

Gene Length:
696

Molecular Weight*:
25637

pI*:
6.35

Net Charge*:
-2.45

EC:
1.3.99.1  

Functional Class:
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Benzoate degradation via CoA ligation
Butanoate metabolism
Carbohydrate Metabolism; Citrate cycle (TCA cycle)
Citrate cycle (TCA cycle)
Energy Metabolism; Oxidative phosphorylation
Oxidative phosphorylation
Reductive carboxylate cycle (CO2 fixation)

Comment:
The structure of this component in general consists of the duplication
of a domain of twenty six amino acid residues; each of these
domains contains four cysteine residues that bind to a 4Fe-4S center. The
enzyme converts succinate to fumarate in a reduction reaction. In B.subtilis,
the enzyme is a trimer consisting of an iron-sulfur subunit, a flavoprotein
and a cytochrome subunit. CT592 is the flavoprotein and CT593 is the
cytochrome.

Blast Summary:  PSI-Blast Search
Hits in gapped blast to succinate dehydrogenase protein sequences.
e.g. residues 1-209 are 52% similar to Paenibacillus macerans
(Y08563). CT591 is very weakly similar to TP0152, a predicted nitrogen fixation protein
of T.pallidum. No similarity to M.genitalium.

CT591 is orthologously related to CPn0790: residues 1-229 of CT591
are 74% similar to residues 27-257 of CPn0790, a predicted succinate
dehydrogenase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0479
COG name: Succinate dehydrogenase/fumarate reductase Fe-S protein
Functional Class: C
The phylogenetic pattern of COG0479 is amt-yQ-CEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 130-141 and 186-197 are matched to block BL00198
concerned with iron-sulphur binding region proteins
e.g. DHSB_BACSU.
Residues 129-139 are matched to block BL00025,
concerned with P-type trefoil domain proteins,
e.g. XP2_XENLA.


ProDom Summary:  Protein Domain Search
Residues 5-209 are 52% similar to Iron-sulfur protein
succinate domain represented by DHSB_BACSU.
Also residues 130-141, 184-199 are 58% and 43% similar to
a ferredoxin putative II domain from FER2_METJA.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MELHPGENVISTLMEIEKNPVNIHGERVDPVVWEQACLEEVCGSCAVSVN
GIPRQACTALIHEHIDAKREIKLAPLSKFPLVRDLIVDRSVMFKNLEEIQ
GWISAEKCGEGAGPKISQEEQTLMYSLSMCMTCGCCTEACPQVNEKSDFM
GPAAIAQARYFNAYPGEKRRESRLRALMGTRGIEGCGQAHNCVQVCPKKL
PLTESISAMGCEVSRFSLRALFSSLFKKKTEE

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAACTACACCCAGGGGAGAATGTGATCAGTACTCTCATGGAAATTGA
AAAGAATCCTGTAAATATTCATGGAGAGCGTGTGGATCCTGTTGTTTGGG
AACAGGCTTGTCTAGAAGAGGTTTGTGGCTCTTGTGCAGTTTCAGTGAAT
GGTATTCCAAGACAAGCTTGCACTGCATTAATTCATGAGCATATAGATGC
TAAAAGAGAGATCAAGTTAGCCCCTCTTTCTAAGTTCCCTTTAGTGCGAG
ATTTGATTGTAGATCGCTCTGTTATGTTCAAAAATTTAGAAGAGATTCAA
GGATGGATTTCTGCAGAGAAATGTGGGGAAGGCGCAGGCCCTAAAATCTC
TCAAGAAGAGCAAACTTTAATGTACTCTTTGTCGATGTGTATGACTTGTG
GCTGTTGCACGGAAGCCTGCCCACAAGTAAATGAAAAAAGTGATTTTATG
GGGCCAGCCGCTATTGCGCAAGCGCGTTATTTTAACGCTTATCCTGGAGA
GAAACGTCGAGAGAGTCGGTTACGAGCATTGATGGGTACCCGAGGAATAG
AGGGATGTGGGCAGGCTCATAATTGTGTGCAAGTATGTCCTAAAAAGTTG
CCTTTAACAGAAAGCATTTCAGCTATGGGATGTGAGGTTTCCCGTTTTTC
TTTGCGAGCATTATTTTCCTCGTTATTCAAGAAAAAAACAGAGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy