Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR471 IGR473 IGR475 IGR476 IGR472 IGR474 pepP, - CT574 CT573 mutL, - CT575 gspD, - CT572 CT577 lcrH_1, - CT576 CT578 pepP, - CT574 CT573 mutL, - CT575 gspD, - CT572 CT577 lcrH_1, - CT576 CT578 Type: tandem, Name:  - 5 pepP, - CT574 CT573 mutL, - CT575 gspD, - CT572 gspE, - CT571 gspE, - CT571 CT577 lcrH_1, - CT576 CT578
* Calculated from Protein Sequence

Gene ID: CT574

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepP  

Definition:
Probable XAA-PRO aminopeptidase

Gene Start:
646654

Gene Stop:
645587

Gene Length:
1068

Molecular Weight*:
39379

pI*:
5.38

Net Charge*:
-7.52

EC:
3.4.11.9  

Functional Class:
translation; proteases  

Pathway: pathway table

Secondary Evidence:
Yoshimoto, T., H. Tone, T. Honda, K. Osatomi, R. Kobayashi, D. Tsuru. 1989.
"Sequencing and high expression of aminopeptidase P gene from Escherichia coli
HB101." J.Biochem.(Tokyo) 105:412-416.

Comment:
If this is an XAA_PRO aminopeptidase, its activity is to remove XAA-Pro dipeptides from N-terminal ends.
Aminopeptidase PII releases any N-terminal amino acid, including proline, that is
linked with proline, even from a dipeptide or tripeptide.
Its cofactor is zince but the inactive apoenzyme can be activated by the addition
of manganese as well as zinc.
Aminopeptidase PII is a homotetramer belonging to peptidase family M24B.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to sequences of peptidases, e.g.
residues 6-356 are 32% similar to YQHT_BACSU.

CT574 is 23% similar to the methionine amino peptidase sequence U39695.
It is also similar to TP0842, a predicted methionine aminopeptidase from T.pallidum.
No significant similarity to M.genitalium.

CT574 is orthologously related to CPn0813: residues 1-356 of CT574 are 52%
similar to residues 1-355 of CPn0555, a predicted XAA-PRO aminopeptidase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0006
COG name: Xaa-Pro aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0006 is amtKYqvcEBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 61-74, 184-195, 203-217, 255-266, 284-296, 327-340
match significantly to blocks BL00491A,B,C,D, concerned with aminopeptidase P
and proline dipeptidase proteins sequences, e.g. Y806_METJA.
Also residues 108-164, 177-198, 203-255, 258-303 are matched to
blocks BL00680A,B,C,D,E, concerned with Methionine aminopeptidase
subfamily 1 protein sequences, e.g. AMP1_SYNY3.

ProDom Summary:  Protein Domain Search
Residues 132-312 are 34% similar to an aminopeptidase domain from
PEPQ_LACDL. Residues 308-328, 314-336 and 326-345 are also similar
to domains from peptidases, namely AMPP_MYCPN, PEPD_HUMAN and PEPQ_ECOLI.

Paralogs:  Local Blast Search
CT574 is paralogously related to CT851,
thought to be a methionine aminopeptidase: residues 127-318
are 26% similar to CT851.



Pfam Summary:  Pfam Search
Residues 283 to 345 (E-value = 3.8e-16) place CT574 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:
gi|809294|pdb|1CHM|A Chain A, Creatine Amidinohydrolase (E.C.3.5.3.3)

Gene Protein Sequence:
MNQNPIKRLQDSLVERALDAFLIEKDEDISYFLQDQARSGVLLITRDEAV
LFVSPLDKDLYARIQDVVLVSYSKSVDQELGSYIENTGLKTIGFDSEYTP
YGIAQKRMNSGYAFSPQSLVAEKLRCVKSTEEIQKMTRAAEIGSAGYDFV
LAALRPGITEKELVRMLHVFWANLGIEKVSFPPIIAFGENAAFPHAIPTN
RSLKKGDVVLIDIGVCYEGYCSDMTRTVAFGATPEQQLLDGYVAVAEAQR
AAIEFCRAGVPCRDVHKEAVRILRAHGMEKAFIHGLGHGVGREVHEYPRL
SPFSDATLQLNMAVTVEPGVYFPGVGGIRIEDTIMIGVNENLNLTNRKVS
SEIIII

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAAAATCCGATCAAACGACTGCAAGATTCTCTAGTGGAGCGCGC
ACTTGATGCTTTTTTGATAGAGAAAGACGAGGATATTAGCTACTTTTTAC
AAGATCAGGCTCGATCAGGAGTTTTATTGATCACTCGTGATGAAGCAGTA
TTGTTTGTGTCTCCATTAGATAAAGATCTCTATGCTCGTATCCAGGATGT
GGTGCTTGTTTCTTATTCTAAAAGTGTGGATCAGGAACTCGGCAGTTATA
TCGAAAATACAGGGTTAAAAACGATAGGCTTTGACAGCGAGTATACTCCT
TACGGGATAGCACAAAAACGAATGAACAGCGGGTATGCATTTTCTCCGCA
AAGTTTAGTTGCGGAGAAGTTACGTTGTGTGAAAAGCACGGAAGAAATCC
AAAAAATGACTCGAGCTGCGGAAATAGGTTCTGCAGGATATGATTTTGTT
CTGGCTGCATTACGCCCAGGGATTACAGAAAAAGAACTGGTTCGGATGCT
TCACGTCTTTTGGGCTAACCTTGGTATAGAAAAGGTCTCTTTTCCTCCCA
TTATTGCATTTGGTGAGAATGCGGCTTTCCCCCATGCAATTCCAACGAAT
CGATCTTTGAAAAAGGGGGATGTGGTGTTGATCGACATTGGCGTTTGCTA
TGAAGGATATTGTTCAGATATGACTCGAACGGTGGCATTTGGAGCGACTC
CAGAACAGCAGCTATTGGATGGATACGTTGCGGTTGCTGAGGCTCAGCGT
GCAGCCATAGAGTTCTGTCGGGCAGGAGTGCCTTGTCGGGATGTTCATAA
GGAAGCTGTGCGTATTTTACGTGCACATGGAATGGAGAAAGCGTTCATTC
ATGGGCTAGGGCATGGCGTGGGAAGAGAGGTCCATGAATACCCTAGGTTA
TCGCCTTTTTCGGATGCCACGCTACAATTGAATATGGCTGTGACTGTAGA
GCCGGGGGTATATTTCCCTGGTGTAGGTGGGATCCGGATTGAAGATACGA
TCATGATAGGTGTGAATGAAAATTTAAATTTAACAAACCGAAAGGTCTCT
TCCGAGATAATTATCATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy