Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR468 IGR465 IGR470 IGR464 IGR463 IGR469 IGR466 IGR467 CT569 CT565 CT567 CT566 gspF, - CT570 gspD, - CT572 yscS,sctS,fliQ, - CT563 sctL,yscL, - CT561 sctT,yscT, - CT564 yscR,sctR, - CT562 CT569 CT565 CT567 CT566 gspF, - CT570 gspD, - CT572 yscS,sctS,fliQ, - CT563 sctL,yscL, - CT561 sctT,yscT, - CT564 yscR,sctR, - CT562 CT565 CT567 CT566 gspF, - CT570 gspD, - CT572 CT568 gspE, - CT571 gspE, - CT571 CT569 CT568 yscS,sctS,fliQ, - CT563 sctL,yscL, - CT561 sctT,yscT, - CT564 yscR,sctR, - CT562
* Calculated from Protein Sequence

Gene ID: CT568

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (acidic)

Gene Start:
638893

Gene Stop:
638441

Gene Length:
453

Molecular Weight*:
17101

pI*:
6.43

Net Charge*:
-0.34

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT568 is orthologously related to CPn0819: residues 13-149 are 48% similar to CPn0819. No similarities to T. pallidum or M. genitalium.


COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
21  
42

PDB Hit:
None.

Gene Protein Sequence:
MNSEGKGTEMAFKRKRCFLLVEVLLSLSLLCTVLIPSVVFYTRITRSFEE
DIFRLQLPACIDYCFFAVEDAIFQQMDREALSLKGEGELVGMYVYTSMGE
AIKIPYSYTLSLLREKRNADGRLLCSVDATVDLFPGQKRGAAAQRCLCLE
R

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAGCGAGGGTAAGGGGACGGAAATGGCTTTCAAACGAAAACGTTG
TTTTTTACTAGTAGAGGTGCTTCTTTCTCTCTCCCTTCTTTGCACAGTGT
TAATTCCTAGTGTGGTGTTTTATACACGGATCACTCGTTCGTTTGAGGAA
GACATTTTTCGCTTACAGCTTCCTGCATGCATCGATTACTGTTTTTTTGC
GGTGGAGGACGCCATATTTCAGCAAATGGATAGAGAAGCTCTCTCCCTGA
AAGGGGAAGGAGAGCTTGTTGGGATGTATGTGTATACGAGTATGGGAGAA
GCTATCAAGATCCCTTATAGCTATACGCTATCCCTCCTAAGAGAAAAACG
TAACGCAGACGGCAGGCTTTTGTGTTCGGTCGACGCTACGGTGGACTTAT
TCCCTGGCCAGAAAAGGGGAGCCGCTGCACAGAGGTGTTTATGTTTAGAA
AGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy