Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR448 IGR451 IGR450 IGR449 IGR447 CT546 aspS, - CT542 CT548 CT547 uhpC, - CT544 dnaE, - CT545 CT546 aspS, - CT542 CT548 CT547 uhpC, - CT544 dnaE, - CT545 Type: tandem, Name:  - 3 CT546 hisS, - CT543 hisS, - CT543 aspS, - CT542 CT548 CT547 uhpC, - CT544 dnaE, - CT545 rsbW, - CT549 rsbW, - CT549
* Calculated from Protein Sequence

Gene ID: CT545

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaE  

Definition:
DNA polymerase III alpha chain

Gene Start:
612542

Gene Stop:
616252

Gene Length:
3711

Molecular Weight*:
139529

pI*:
6.07

Net Charge*:
-16.80

EC:
2.7.7.7  

Functional Class:
DNA replication and repair  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
The alpha chain is responsible for the polymerase activity of the multichain
enzyme. Other subunits perform 3' to 5' exonucleolytic activity. See
CT187 and CT334 for gamma and tau chain sequences. See CT075 for a beta chain sequence.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to DNA polymerase III alpha chain sequences,
e.g. residues 6-1070 are 38% similar to DP3A_HELPY. CT545 is similar to TP0669
in T.pallidum and to MG261 in M.genitalium.

CT545 is orthologously related to CPn0666 and
they share 70% similarity.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0587
COG name: DNA-dependent DNA polymerase III alpha chain
Functional Class:  L
The phylogenetic pattern of COG0587 is -----qvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 441-961 are 45% similar to a pol III alpha chain domain as observed
in DP3A_ECOLI. Residues 6-281, 343-440, 435-491, 546-837, 732-745, 835-851,
875-928 also correspond to pol III alpha chain domains, as seen in
DP3A_HELPY, DP3A_SALTY, DP3A_MYCPU, DP31_MYCPN, DP3A_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 4 to 69 (E-value = 3.1e-34) place CT545 in the PHP_N family which is described as PHP domain N-terminal region (PF02231)
Residues 85 to 235 (E-value = 1.3e-40) place CT545 in the PHP_C family which is described as PHP domain C-terminal region (PF02811)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
123  
214
non-globular  
1055  
1128

PDB Hit:
none

Gene Protein Sequence:
MTWIPLHCHSQYSILDATCSIKKFVAKAVEYQIPALALTDHGNLFGAVEF
YKTCKQNAIKPIIGCELYVAPSSRFDKKKERKSRVANHLILLCKDEEGYR
NLCLLSSLAYTEGFYYVPRIDRDLLSQHSKGLICLSACLSGSVAQAALES
EEDLEKDLLWYQDLFQEDFFSEVQLHKSSEEKVALFEETWLKQNYYQFIE
KQLKVNEAVLATSKRLGIPSVATNDIHYLNPDDWLAHEILLNVQSREPIR
TAKQNTYIPNPKRKTYPSREFYFKSPQEIAELFAAHPETITNTCIVAERC
HLELDFETKHYPIYVPEALQKKGSYTEEERYKASSAFLEELCEQGLTSKY
TPELLGHIAKKFPGEDPLTLVKERLKLESSIIISKGMCDYLLIVWDIINW
AKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERISYP
DIDIDICMIGRERVINYAIERHGKDNVAQIITFGTMKAKMAIKDVGRTLD
TPLAKVNFIAKHIPDLNATITSALEADPELRQLYVDDAEAAEVIDMAKKL
EGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESVGM
LKVDFLGLKTLTGIHIATQAIYKKTGILLRAATIPLDDQNTFSLLHQGKT
MGIFQMESRGMQDLAKNLRPDAFEEIIAIGALYRPGPMDMIPSFINRKHG
KENIEYDHPLMEPILKETFGIMVYQEQVMQIAGSLAKYSLGEGDVLRRAM
GKKDHEQMVKEREKFCSRAAANGIDPSIATTIFDKMEKFASYGFNKSHAA
AYGLITYTTAYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNILVL
PPDINESGQDFEATQKGIRFSLGAVKGVGMSIVDSIVEEREKNGPYKSLQ
DFVQRADFKKVTKKQLENLVDAGTFDCFEPNKDLALAILNDLYDTFSREK
KEAATGVLTFFSLDSMARDPVKITVSPENVIQRSPKELLKREKELLGVYL
TAHPMDAVEHMLPFLSVVPARDFEGLPHGTIIRTVFLIDKVTTKISSAEQ
KKFALLQVSDEVDSYELPIWADMYAEYRDLLEEDRLIYAILAIDRRSDSL
RLSCRWMRDLSTVNDSVIAECDEVYDRLKSQKVYSSTKKSTGAQSSAMIK
KVETREISPVTISLDLNKLRHSHLFILKGLIRKYSGSQALSLVFTKDNQR
FASISPDADFFVTDDISSLLQEIEATNIPARVLATTV

Gene Nucleotide Sequence:  Sequence Viewer
TTGACCTGGATTCCATTACATTGCCACTCTCAGTATTCCATCTTGGATGC
AACATGCTCAATCAAGAAGTTTGTTGCCAAAGCAGTGGAATATCAAATTC
CCGCGCTCGCTCTTACCGATCACGGGAATTTGTTTGGCGCGGTCGAATTT
TATAAGACCTGTAAACAAAACGCGATTAAACCTATCATCGGGTGTGAGCT
ATACGTCGCACCCTCTTCTCGTTTCGATAAAAAAAAAGAACGAAAAAGCC
GAGTTGCCAACCATCTCATCCTTCTTTGTAAAGATGAAGAAGGGTATCGC
AACCTTTGTTTGCTCTCCTCTCTTGCTTACACAGAAGGTTTTTACTATGT
GCCTCGCATAGATAGAGATCTTTTGAGCCAACACTCCAAAGGACTTATCT
GCTTATCAGCCTGTTTATCCGGATCGGTTGCTCAAGCTGCATTGGAATCT
GAAGAAGATTTAGAAAAAGATCTTTTATGGTATCAAGATCTGTTTCAAGA
AGACTTTTTCAGTGAAGTACAACTCCACAAATCCTCAGAAGAAAAAGTTG
CTCTATTTGAAGAAACTTGGTTAAAACAAAACTACTATCAATTCATTGAG
AAACAACTCAAAGTAAATGAAGCTGTTTTAGCTACTTCTAAACGCCTTGG
TATTCCTTCAGTTGCTACAAATGATATTCACTATTTGAATCCGGACGATT
GGCTCGCTCATGAAATTTTACTCAATGTTCAGTCTAGAGAGCCTATTCGG
ACAGCTAAACAAAATACTTACATTCCCAATCCTAAACGCAAAACCTATCC
TAGTAGGGAATTTTATTTTAAATCCCCTCAAGAGATCGCAGAGCTATTTG
CAGCACATCCAGAGACTATTACCAATACGTGTATCGTTGCCGAGCGCTGC
CACCTAGAGCTTGATTTTGAAACCAAACACTATCCTATCTACGTCCCAGA
AGCTTTACAAAAAAAAGGATCCTACACAGAAGAGGAGCGCTACAAAGCAT
CCTCAGCCTTCTTAGAAGAACTTTGCGAGCAAGGATTAACCAGCAAATAC
ACACCCGAGCTTCTAGGACACATTGCAAAGAAATTCCCTGGGGAAGACCC
TCTTACGCTGGTTAAAGAACGTCTCAAATTGGAATCCTCTATTATTATCT
CCAAAGGGATGTGCGATTACTTGCTCATTGTCTGGGATATTATTAACTGG
GCAAAAGATCATGGGATTCCTGTTGGCCCCGGTCGAGGCTCTGGAGCGGG
CTCTGTCATGCTTTTCCTTCTGGGGATTACTGAAATAGAACCGATTCGCT
TCGACCTTTTCTTCGAACGTTTCATCAACCCGGAACGGATATCGTATCCC
GATATCGATATCGATATCTGTATGATTGGCAGAGAGCGCGTTATTAACTA
TGCTATAGAACGTCATGGTAAAGATAATGTAGCCCAAATTATTACATTTG
GCACCATGAAAGCCAAAATGGCTATTAAGGATGTGGGTAGAACTTTAGAT
ACCCCCTTAGCTAAAGTGAACTTCATCGCGAAACATATTCCCGATCTTAA
TGCTACCATTACTTCGGCATTAGAGGCTGATCCAGAATTAAGGCAACTGT
ATGTAGATGACGCTGAAGCTGCAGAAGTTATTGATATGGCTAAAAAACTA
GAGGGATCTATCCGCAATACTGGAGTGCATGCTGCGGGAGTGATTATCTG
TGGAGATCCTCTCACTAACCATATCCCGATTTGTGTCCCTAAAGACTCAT
CCATGATTTCTACTCAGTACTCAATGAAGCCAGTAGAAAGCGTTGGCATG
CTTAAAGTGGATTTTTTGGGTCTAAAAACCTTAACCGGCATTCACATCGC
CACACAGGCGATCTATAAAAAAACAGGCATTCTACTCCGGGCTGCCACGA
TTCCTCTAGATGACCAGAATACTTTCTCTCTTCTTCATCAAGGTAAAACC
ATGGGGATCTTCCAAATGGAATCTCGTGGCATGCAAGACCTTGCTAAAAA
CTTACGCCCAGATGCGTTTGAAGAAATTATAGCGATCGGAGCCCTCTATC
GCCCTGGCCCTATGGATATGATCCCATCATTTATCAATAGGAAGCATGGT
AAAGAGAATATTGAATACGACCATCCTCTCATGGAACCTATTCTAAAAGA
AACTTTTGGAATTATGGTTTACCAAGAACAAGTCATGCAGATTGCCGGTT
CATTAGCAAAATACTCTTTGGGAGAAGGGGATGTTTTACGCCGCGCTATG
GGGAAAAAAGACCATGAACAGATGGTCAAGGAACGAGAGAAATTTTGTTC
AAGAGCCGCAGCGAATGGCATCGACCCTTCCATAGCAACGACTATCTTCG
ATAAGATGGAAAAGTTTGCTTCCTATGGATTTAATAAGTCCCATGCCGCA
GCTTACGGTCTTATAACCTACACAACAGCATATCTTAAAGCCAACTACCC
CAAAGAATGGCTTGCCGCCCTTCTCACTTGCGATTATGACGATATTGAGA
AAGTTGGGAAGCTAATTCAAGAAGCTCACAGTATGAACATTCTCGTTCTG
CCTCCTGATATTAATGAGTCTGGACAAGATTTTGAAGCCACTCAGAAAGG
GATTCGCTTTTCTCTAGGAGCTGTCAAAGGCGTTGGAATGAGCATTGTGG
ATAGTATTGTTGAAGAGAGAGAAAAAAACGGCCCCTATAAAAGTCTGCAG
GATTTCGTTCAACGCGCAGATTTTAAAAAAGTCACTAAGAAACAGCTTGA
AAATTTGGTGGATGCAGGAACCTTTGACTGCTTCGAACCTAATAAAGATC
TTGCGCTGGCAATCCTTAATGACCTTTACGACACGTTCTCTAGAGAAAAA
AAAGAAGCTGCTACAGGAGTCCTAACCTTTTTTTCACTAGATAGCATGGC
TAGAGATCCTGTTAAAATTACTGTCTCTCCTGAAAATGTTATCCAACGCT
CTCCTAAGGAGTTGTTGAAAAGAGAAAAAGAATTACTTGGAGTATATTTG
ACTGCCCATCCTATGGATGCTGTTGAACACATGCTCCCTTTCTTATCTGT
AGTCCCAGCTCGAGATTTTGAAGGACTCCCTCATGGAACCATTATTCGTA
CAGTCTTTCTAATCGATAAAGTCACTACTAAAATTTCCTCTGCAGAGCAG
AAAAAATTTGCACTTTTACAAGTCAGCGATGAAGTCGATTCATATGAACT
TCCAATCTGGGCCGATATGTACGCCGAATACCGTGATCTATTGGAAGAAG
ATCGTCTTATTTATGCCATTTTGGCTATAGATCGACGTAGTGATTCCTTG
CGTCTATCTTGTCGGTGGATGCGAGACTTATCTACCGTTAATGATTCAGT
AATTGCGGAATGCGACGAAGTCTATGATCGACTGAAAAGTCAGAAAGTAT
ACTCTTCAACGAAAAAATCAACCGGAGCCCAGTCCTCAGCAATGATAAAG
AAAGTAGAGACTAGAGAGATCTCTCCCGTAACCATCTCTTTAGATTTAAA
TAAATTACGCCATAGCCACTTATTTATTCTCAAAGGGCTGATACGCAAAT
ATTCTGGATCTCAAGCACTCTCTCTTGTATTCACAAAAGATAATCAGCGG
TTCGCCTCTATCTCTCCAGATGCAGATTTTTTCGTAACAGATGATATCTC
TTCTCTTCTTCAAGAAATTGAAGCAACCAATATCCCTGCTCGCGTTCTAG
CCACTACAGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy