Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR448 IGR445 IGR444 IGR446 IGR447 IGR443 spoU,yibK, - CT540 CT538 mip, - CT541 aspS, - CT542 trxA, - CT539 uhpC, - CT544 dnaE, - CT545 spoU,yibK, - CT540 CT538 mip, - CT541 aspS, - CT542 trxA, - CT539 uhpC, - CT544 dnaE, - CT545 Type: tandem, Name:  - 3 spoU,yibK, - CT540 CT538 mip, - CT541 aspS, - CT542 hisS, - CT543 hisS, - CT543 trxA, - CT539 uhpC, - CT544 dnaE, - CT545
* Calculated from Protein Sequence

Gene ID: CT543

DNA Molecule Name:
1  

Genbank ID:
3328982

Gene Name:
hisS  

Definition:
histidyl-tRNA synthetase

Gene Start:
610722

Gene Stop:
609439

Gene Length:
1284

Molecular Weight*:
49177

pI*:
7.15

Net Charge*:
0.78

EC:
6.1.1.21  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
In HAEIN, the his-tRNA synthetase appears to be a homodimer.

Histidyl-tRNA synthetase is a cytoplasmically located homodimer with
similarity to class-II aminoacyl-tRNA synthetases.
Reaction: ATP + l-histidine + tRNA(his) = AMP + pyrophosphate +
l-histidyl-tRNA(his).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to histidyl-tRNA synthetase sequences, e.g.
residues 1-4-3 are 42% similar to the B.subtilis enzyme (Z99118). CT543
is similar to TP0641 in T.pallidum and to MG035 in M.genitalium, both
his-tRNA synthetases.

CT543 is orthologously related to CPn0663: residues 5-427 of CT543 are
66% similar to residues 5-427 of CPn0663, a predicted histidyl-tRNA
synthetase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0124
COG name: Histidyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0124 is amtkYQVCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 197-321 are 50% similar to a his-tRNA synthetase
domain as observed in SYH_STREQ. Residues 32-101, 108-195,
145-402 support this assignment as evidenced by similarities to
domains of SYH_METJA, SYH_HAEIN, SYH_ECOLI. Residues 46-87
and 231-360 are similar to protein kinase GCN2 domains as
observed in GCN2_YEAST.


Paralogs:  Local Blast Search
CT543 is weakly paralogous to CT581, thought to be a threonyl-tRNA synthetase: residues 292-402 are 22% similar to CT581.

Pfam Summary:  Pfam Search
Residues 8 to 165 (E-value = 1.5e-39) place CT543 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 334 to 424 (E-value = 3.2e-08) place CT543 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:
gi|2781066|pdb|1KMM|A Chain A, Histidyl-Trna Synthetase Complexed With Histidyl-Adenylate Aminoacyl-Trna Synthase, Ligase, Synthetase Mol_id: 1; Molecule: Histidyl-Trna Synthetase; Chain: A, B, C, D; Synonym: Histidine-Trna Ligase; Ec: 6.1.1.21; Engineere

Gene Protein Sequence:
MSNALPKGVFDIFPYVTSPKNLWRNSSLWKRVEHAAHRICNLYGFDEIRT
PVFEKTETFLRVGEYSDIVKKEVYTFLDKKRRSLTLRPEGTAAVVRALLD
HSADMRKDNKFYYILPMFRYERQQSGRYRQHHQFGLEAIGVRHPLRDAEV
LSLLWDFYAAVGLQHMQIHVNFLGGQKTRARYDEALREFFRKDLDRLSPL
SQERYHANLLRILDSKEPEDQEFIEKAPSILDYIDDRDLSYFDAVLAQLK
ALGISFAINPRLVRGLDYYTDLVFEAVTVVGEHSYALGGGGRYDELVAQS
GGPSMPAFGFGVGLERVIQTLLEQGNSLSTSTRRLRLIPMDEQADAFCFS
WANRLRNLGIATEVDWSHKKPKLSLKDAADQQVSFVCLLGEQELATKQFI
VKDMSLHQSFSGAQQDVEQRLVYEVQNA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAATGCATTGCCAAAAGGCGTTTTTGATATTTTTCCCTATGTAAC
AAGCCCAAAAAATCTTTGGAGAAATTCTTCTCTATGGAAACGTGTTGAGC
ATGCAGCCCATCGTATTTGTAATTTATATGGATTTGATGAGATCCGAACT
CCAGTTTTTGAAAAGACAGAGACTTTTTTACGCGTCGGAGAGTACAGTGA
TATTGTAAAAAAGGAAGTTTATACCTTCTTAGATAAAAAAAGACGTTCTT
TGACTTTGCGTCCAGAAGGGACTGCAGCAGTTGTTCGTGCATTGTTGGAT
CATTCTGCTGATATGCGCAAAGATAATAAGTTTTATTATATTTTGCCCAT
GTTTCGTTACGAGCGGCAACAATCTGGACGTTACCGTCAGCATCATCAGT
TCGGTCTAGAAGCTATCGGTGTGCGGCACCCCTTACGAGATGCGGAGGTG
CTCTCTCTGTTATGGGATTTTTATGCAGCGGTCGGGCTTCAGCATATGCA
AATCCATGTGAATTTTTTAGGAGGGCAAAAGACTCGGGCTCGTTATGACG
AAGCTTTGCGGGAGTTCTTCCGTAAGGATCTAGACCGGTTATCGCCTCTG
AGTCAAGAAAGATATCATGCGAACTTATTGCGTATATTAGATTCTAAGGA
GCCAGAAGACCAGGAATTCATTGAAAAAGCTCCCTCAATTTTGGATTACA
TAGATGATCGGGATTTAAGCTATTTTGATGCAGTATTAGCCCAATTAAAG
GCTTTAGGGATTTCTTTTGCAATCAATCCAAGGCTAGTTCGAGGGTTGGA
TTATTATACGGATCTTGTATTTGAAGCGGTGACTGTTGTGGGAGAGCACT
CCTATGCATTGGGAGGCGGCGGGCGTTATGATGAATTGGTTGCGCAGTCT
GGAGGCCCTTCTATGCCAGCTTTTGGTTTTGGAGTGGGATTGGAAAGAGT
AATCCAAACGCTATTAGAGCAAGGAAACTCTTTATCGACCTCTACGCGAC
GGTTGCGATTAATTCCTATGGATGAGCAGGCAGATGCATTTTGTTTTTCA
TGGGCAAATCGTTTACGTAACCTAGGCATTGCAACAGAAGTAGATTGGAG
CCATAAGAAGCCTAAATTGTCTCTTAAAGATGCTGCCGATCAACAAGTCA
GTTTTGTTTGTCTCTTAGGCGAACAAGAATTAGCAACGAAACAATTTATA
GTTAAAGATATGTCTTTGCATCAAAGCTTCTCAGGGGCTCAACAAGATGT
AGAACAAAGGTTGGTTTATGAAGTACAGAACGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy