Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR442 IGR448 IGR445 IGR444 IGR446 IGR447 IGR443 spoU,yibK, - CT540 CT538 mip, - CT541 dnaQ, - CT536 aspS, - CT542 trxA, - CT539 uhpC, - CT544 dnaE, - CT545 spoU,yibK, - CT540 CT538 mip, - CT541 dnaQ, - CT536 aspS, - CT542 trxA, - CT539 uhpC, - CT544 dnaE, - CT545 Type: tandem, Name:  - 3 spoU,yibK, - CT540 CT538 mip, - CT541 dnaQ, - CT536 aspS, - CT542 CT537 hisS, - CT543 CT537 hisS, - CT543 trxA, - CT539 uhpC, - CT544 dnaE, - CT545
* Calculated from Protein Sequence

Gene ID: CT542

DNA Molecule Name:
1  

Genbank ID:
3328981

Gene Name:
aspS  

Definition:
aspartyl-tRNA synthetase

Gene Start:
609455

Gene Stop:
607710

Gene Length:
1746

Molecular Weight*:
66218

pI*:
5.13

Net Charge*:
-17.37

EC:
6.1.1.12  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Primary Evidence:
Rockey DD, Chesebro BB, Heinzen RA, Hackstadt T. 1996. A 28 kDa major immunogen of Chlamydia psittaci shares identity with Mip proteins of Legionella spp and Chlamydia trachomatis: cloning and characterization of the Chlamydia psittaci mip-like gene. Microbiology-UK 142(pt.4): 945-953. Medline: 8936321.

Comment:
Aspartyl-tRNA synthetase is believed to be a homodimer and cytoplasmic. Through similarity, it belongs to class-II aminoacyl-tRNA synthetases. Reaction: ATP + l-aspartate + tRNA(asp) = AMP + pyrophosphate + l-aspartyl-tRNA(asp).

*Notice the gene order: aspS-mip-spoU-trxA.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to aspartyl-tRNA synthetase sequences, e.g. residues 4-582 are 48% similar to the enzyme from B.subtilis (Z99118). CT542 is similar to TP0985 in T.pallidum and to MG036 in M.genitalium.

CT542 is orthologously related to CPn0662: residues 1-582 of CT542 are 78% to residues 1-582 of CPn0662, a predicted aspartyl-tRNA synthetase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0173
COG name: Aspartyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0173 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 158-478 are 51% similar to a lysyl-aspartyl tRNA synthetase domain as observed in SYD_THETH. Residues 17-78, 20-50, 64-106, 122-157, 479-553 also correspond to defined synthetase domains as seen in SYD_ECOLI, SYD_PYRSK, SYD_MYCLE, SYD_THETH, SYD_SYNY3.

Paralogs:  Local Blast Search
CT542 is paralogously related to CT781, thought to be a lysyl-tRNA synthetase: residues 92-303 and 443-554 are 25% and 30% similar to stretches of CT781.

Pfam Summary:  Pfam Search
Residues 20 to 105 (E-value = 8.9e-20) place CT542 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 123 to 558 (E-value = 3.5e-18) place CT542 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)
Residues 313 to 406 (E-value = 1.9e-44) place CT542 in the GAD family which is described as GAD domain (PF02938)

PDB Hit:
gi|1311301|pdb|1LYL|A chain A, lysyl-tRNA synthetase (LysU) (e.c.6.1.1.6) complexed with lysine mol_id: 1; molecule: lysyl-tRNA synthetase (LysU); chain: a, b, c; ec: 6.1.1.6; mol_id: 2; molecule: lysine; chain: x, y, z.

Gene Protein Sequence:
MKYRTHKCNELSLDHVGEHVRLSGWVHRYRNHGGVVFIDLRDCFGITQIV
CRQEENPELHQLMDQVRSEWVLCVEGLVCARLEGMENPNLVTGSIEVEVS
SLEVLSRAQNLPFSISDEHINVNEELRLTYRYLDMRRGDILDRLMCRHKV
MLACRQYLDEQGFTEVVTPILGKSTPEGARDYLVPSRIYPGNFYALPQSP
QLFKQILMVGGLDRYFQIATCFRDEDLRADRQPEFTQIDMEMSFGGPEDL
FPVVEELVARLFAVKGIELKAPFLRMTYQEAKDSYGTDKPDLRFGLRLKN
CCEYARKFTFSIFLDQLAYGGTVKGFCVPGGADMSRKQLDIYTDFVKRYG
AMGLVWIKKQDGGVSSNVAKFASEDVFQEMFEAFEAKDQDILLLIAAPEA
VANQALDHLRRLIARERQLYDSTQYNFVWITDFPLFAKEEGELCPEHHPF
TAPLDEDISLLDSDPFAVRSSSYDLVLNGYEIASGSQRIHNPDLQNKIFA
LLKLSQESVKEKFGFFIDALSFGTPPHLGIALGLDRIMMVLTGAETIREV
IAFPKTQKAGDLMMSAPSEILPIQLKELGLKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTACAGAACGCATAAATGTAATGAGTTGTCCCTTGATCATGTGGG
GGAACATGTTCGTTTGTCTGGGTGGGTGCATCGTTACCGTAACCATGGGG
GAGTTGTTTTCATTGATTTGCGAGATTGCTTTGGGATTACTCAGATAGTG
TGTCGGCAAGAGGAAAACCCAGAACTTCATCAGCTTATGGATCAAGTCCG
TTCAGAGTGGGTGCTTTGTGTGGAAGGACTTGTTTGTGCTCGGCTAGAGG
GGATGGAGAACCCGAATTTGGTTACAGGTTCTATTGAGGTAGAGGTTTCT
TCCTTGGAAGTGTTGTCTCGGGCACAGAATCTTCCTTTTTCCATTTCTGA
TGAACACATTAATGTAAACGAAGAACTGCGGTTAACTTATCGCTATTTAG
ATATGCGCCGTGGCGATATTTTGGACAGATTAATGTGCCGACATAAAGTT
ATGTTAGCTTGCAGACAGTATTTGGATGAACAAGGTTTTACAGAGGTAGT
TACGCCTATCTTAGGAAAATCTACTCCGGAAGGAGCAAGAGACTACTTAG
TCCCTTCCCGTATCTATCCAGGGAATTTTTATGCTCTTCCACAGTCTCCA
CAGTTGTTTAAACAGATTTTGATGGTTGGAGGTTTGGATCGGTATTTCCA
AATAGCGACCTGTTTCCGTGATGAAGATTTGCGTGCGGACCGTCAACCTG
AGTTTACACAGATCGATATGGAAATGAGCTTTGGTGGGCCAGAGGATCTC
TTTCCAGTGGTAGAAGAGCTTGTTGCACGTTTATTTGCTGTGAAAGGGAT
TGAATTAAAGGCGCCTTTCCTGAGAATGACGTATCAAGAAGCTAAAGACT
CCTATGGAACGGACAAACCAGATTTACGTTTCGGCTTGCGCCTCAAAAAT
TGTTGTGAATATGCACGCAAATTCACATTCTCGATTTTCTTAGATCAATT
AGCTTACGGTGGGACAGTTAAAGGATTTTGTGTTCCGGGCGGAGCAGATA
TGTCTAGAAAGCAGTTAGATATCTATACAGATTTCGTTAAGCGCTATGGA
GCTATGGGGTTAGTATGGATTAAAAAACAAGACGGGGGTGTATCGTCTAA
TGTTGCCAAATTCGCTTCGGAAGACGTATTCCAAGAAATGTTTGAAGCTT
TTGAGGCAAAAGACCAAGATATTTTATTGTTAATAGCAGCTCCAGAGGCT
GTTGCTAACCAGGCATTAGATCATTTGCGTAGGTTGATTGCGAGAGAGCG
TCAACTTTATGATTCAACGCAATATAATTTTGTATGGATCACGGACTTCC
CGCTTTTTGCTAAAGAGGAAGGCGAGTTATGTCCAGAGCATCATCCTTTC
ACAGCTCCATTAGACGAGGATATCTCGCTTTTAGACTCAGATCCTTTTGC
TGTTCGTTCATCGAGCTATGATTTGGTGTTAAATGGTTATGAAATTGCTT
CTGGTTCTCAGCGTATACATAATCCAGATTTGCAAAATAAAATATTTGCT
TTATTAAAGCTGTCGCAAGAAAGTGTAAAAGAGAAGTTCGGGTTTTTTAT
TGATGCGTTGAGTTTTGGGACTCCTCCACATTTAGGGATTGCTCTGGGAT
TAGATCGTATTATGATGGTTCTAACAGGAGCGGAAACTATTCGAGAAGTG
ATTGCGTTCCCTAAAACACAGAAAGCAGGAGATTTGATGATGTCGGCACC
TTCAGAAATTTTGCCGATTCAATTAAAAGAACTGGGGTTGAAACTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy