Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR442 IGR438 IGR445 IGR444 IGR440 IGR439 IGR441 IGR446 IGR443 spoU,yibK, - CT540 fabZ, - CT532 vldD,yciA, - CT535 CT538 mip, - CT541 dnaQ, - CT536 lpxA, - CT531 lpxC, - CT533 cutE,lnt, - CT534 aspS, - CT542 trxA, - CT539 spoU,yibK, - CT540 fabZ, - CT532 vldD,yciA, - CT535 CT538 mip, - CT541 dnaQ, - CT536 lpxA, - CT531 lpxC, - CT533 cutE,lnt, - CT534 aspS, - CT542 trxA, - CT539 spoU,yibK, - CT540 vldD,yciA, - CT535 CT538 mip, - CT541 dnaQ, - CT536 lpxA, - CT531 lpxC, - CT533 cutE,lnt, - CT534 aspS, - CT542 CT537 CT537 fabZ, - CT532 trxA, - CT539
* Calculated from Protein Sequence

Gene ID: CT537

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic) (possible ATPase or kinase)

Gene Start:
604592

Gene Stop:
604122

Gene Length:
471

Molecular Weight*:
17548

pI*:
4.45

Net Charge*:
-10.51

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Could be an ATPase or kinase (yjeE).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to hypothetical proteins in bacteria,
e.g. residues 20-120 are 33% similar to a hypothetical protein from Synechocystis (D90914).
Residues 12-114 are 38% similar to YJEE_ECOLI. CT537 is similar to TP0875 in
T.pallidum. No similarity to M.genitalium.

CT537 is orthologously related to CPn0657: residues 1-142 of CT537 are 51%
similar to residues 1-138 of CPn0657, a predicted conserved hypothetical protein
from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0802
COG name: Predicted nucleotide-binding protein, YjeE family
Functional Class:  R
The phylogenetic pattern of COG0802 is -----qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 28-53 are matched to block PR00193B, concerned with myosin sequences, e.g.
S45474.

ProDom Summary:  Protein Domain Search
Residues 29-114 are 39% similar to a domain from the hypothetical protein
YJEE_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 14 to 140 (E-value = 1.7e-61) place CT537 in the UPF0079 family which is described as Uncharacterised P-loop hydrolase UPF0079 (PF02367)

PDB Hit:
none

Gene Protein Sequence:
MGRYRRVTHSCEETIDLATRVGRDLTLGMVVLLSGDYGSGKTEFVRGIVQ
GFLGEAAVDQVASPSFALLHVYEAGGRRVCHYDLYRLETMDIKNGADLFQ
DAEEEDLICVEWPEAVNLLPQFRKSVCVQMRSLTDAQREVSIGVTDSCDL
SFFMEND

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAGATACAGAAGAGTAACTCACTCGTGTGAAGAGACTATAGACTT
AGCTACTAGGGTTGGTCGGGACCTAACTCTTGGTATGGTTGTTTTATTAT
CAGGGGACTACGGCTCAGGAAAGACAGAGTTTGTTAGAGGGATCGTTCAA
GGGTTTTTAGGGGAGGCAGCTGTCGATCAGGTGGCTAGCCCCTCTTTCGC
TTTGCTTCATGTTTATGAAGCAGGTGGGCGCAGAGTTTGCCATTATGATT
TGTATCGTCTTGAGACGATGGATATTAAGAACGGAGCAGATCTTTTCCAA
GACGCAGAGGAAGAAGATCTTATTTGTGTCGAATGGCCAGAAGCCGTGAA
TTTGCTTCCACAATTCCGCAAAAGTGTTTGTGTGCAGATGCGCTCGCTTA
CGGATGCACAAAGAGAAGTAAGTATAGGAGTCACAGACAGTTGTGATTTG
AGCTTTTTTATGGAGAACGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy