Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR442 IGR435 IGR438 IGR440 IGR439 IGR441 IGR437 IGR436 IGR443 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 CT538 dnaQ, - CT536 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 CT538 dnaQ, - CT536 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 CT538 dnaQ, - CT536 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 CT537 lpxA, - CT531 CT537 lpxA, - CT531
* Calculated from Protein Sequence

Gene ID: CT533

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxC  

Definition:
UDP-3-O-acyl-GlcNAc deacetylase

Gene Start:
600952

Gene Stop:
600095

Gene Length:
858

Molecular Weight*:
31265

pI*:
5.96

Net Charge*:
-6.63

EC:
3.5.1.-  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  
fatty acid and phospholipid metabolism  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:
This enzyme is involved in lipid A biosynthesis: the acetyl group is removed
through hydrolysis from UDP-3-O-(3-hydroxytetradecanoyl)-N-acetylglucosamine.
See CT243, CT411, and CT531.

Blast Summary:  PSI-Blast Search
A few hits in gapped BLAST to UDP-3-O-acyl N-acetylglucosamine deacetylase
sequences, e.g. residues 6-283 are 37% similar to LPXC_HAEIN. No similarities to
T.pallidum or M.genitalium.

CT533 is orthologous to CPn0652: residues 1-279 are 72% similar to CPn0652.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0774
COG name: UDP-3-0-acyl-N-acetylglucosamine deacetylase
Functional Class:  M
The phylogenetic pattern of COG0774 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 263-278 are matched to block PR00718A, concerned with phospholipase
D signatures, as in HUMPHOSPDL.

ProDom Summary:  Protein Domain Search
Residues 6-283 are 37% similar to a N-acetylglucosamine deacetylase domain
as observed in LPXC_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 279 (E-value = 1.1e-177) place CT533 in the LpxC family which is described as UDP-3-O-acyl N-acetylglycosamine deacetylase (PF03331)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
248  
265

PDB Hit:
none

Gene Protein Sequence:
MLGRAQRTLKRKVCYSGVGVHFGKAAMLTLEPAEENTGVVFSHHAASEQY
IPARLANVCGTGRSTTLSLDGSVISTVEHLLASLYSFGVDNVRIYCSEDE
IPIGDGSAQVFMDLIDQAGIQEQEQTVQIARLAHPVYYQYQDTILAAFPS
DEFKISYTLHYSHNSTIGTQYRSLVISEESFRKEIAPCRTFALYSELCFL
MEKGLIGGGCVGNAVLFKDDGVISLGKLRFPDEPVRHKILDLIGDLSLVG
TPFLAHVIAVGSGHSSNIALGNRILEALQHEQELVK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGGTCGAGCTCAGAGAACGTTAAAGCGTAAGGTATGCTATTCCGG
GGTGGGAGTGCATTTTGGAAAAGCTGCGATGCTTACTCTAGAGCCCGCAG
AGGAAAATACAGGCGTAGTTTTCTCTCATCATGCAGCTTCTGAACAGTAT
ATTCCCGCTCGATTGGCGAATGTTTGTGGAACGGGACGTAGCACCACATT
GTCTTTAGATGGTAGTGTTATATCTACGGTAGAACACTTGTTGGCATCGC
TCTACTCCTTCGGAGTGGATAATGTGCGTATCTATTGCAGCGAAGATGAA
ATCCCCATAGGTGATGGTAGTGCTCAGGTGTTTATGGACCTGATAGACCA
GGCAGGGATTCAAGAGCAGGAGCAGACGGTCCAGATCGCAAGGCTTGCTC
ATCCTGTCTATTATCAGTATCAGGATACGATTTTAGCAGCATTTCCTTCG
GATGAGTTTAAAATTTCGTATACCCTGCACTATTCGCATAACTCTACGAT
AGGCACGCAATATCGTTCCTTGGTTATTTCCGAAGAATCTTTTCGTAAGG
AAATCGCTCCTTGCAGGACGTTTGCTTTGTACAGCGAACTCTGCTTCCTC
ATGGAAAAAGGGTTGATAGGAGGGGGCTGTGTAGGTAATGCCGTATTATT
TAAAGACGATGGCGTGATTAGCTTGGGTAAGCTGCGTTTCCCTGATGAGC
CTGTTCGCCATAAAATACTAGATCTAATAGGAGATTTGTCTTTAGTTGGA
ACGCCTTTTTTAGCACATGTTATTGCCGTGGGATCGGGGCATTCTTCCAA
TATTGCATTGGGGAACAGAATTTTAGAGGCGTTGCAGCATGAACAGGAGT
TAGTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy