Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR442 IGR435 IGR438 IGR434 IGR440 IGR439 IGR441 IGR437 IGR436 rl23, - CT526 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 CT538 dnaQ, - CT536 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 rl23, - CT526 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 CT538 dnaQ, - CT536 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 dnaQ, - CT536 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 CT537 lpxA, - CT531 lpxA, - CT531 CT538 rl23, - CT526 CT537
* Calculated from Protein Sequence

Gene ID: CT532

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabZ  

Definition:
(3R)-hydroxymyristoyl-acp-dehydratase

Gene Start:
600095

Gene Stop:
599637

Gene Length:
459

Molecular Weight*:
16607

pI*:
10.00

Net Charge*:
3.47

EC:
4.2.1.-  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism

Comment:
In E.coli, the (3R)-hydroxymyristoyl-ACP dehydratase is involved in lipid A
biosynthesis. See Mohan et al., J.Biol.Chem. 269:32896 (1994).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to (3R)-hydroxymyristoyl-(acyl carrier protein)-dehydratase
sequences, e.g. residues 7-143 are 44% similar to FABZ_ECOLI. No similarities
to T.pallidum or M.genitalium.

CT532 is orthologous to CPn0651: residues 1-153 are 75% similar to CPn0651.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0764
COG name: 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases
Functional Class:  I
The phylogenetic pattern of COG0764 is -----qvcEB-Huj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 61-85 are matched to block PR00177E, concerned with NMDA receptor
signatures, e.g. in S33754.

ProDom Summary:  Protein Domain Search
Residues 10-140 are 46% similar to a dehydratase domain as observed in
FABZ_ECOLI. Residues 23-107 are 34% similar to a related domain seen in
FABA_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 52 to 141 (E-value = 4.6e-18) place CT532 in the 4HBT family which is described as Thioesterase superfamily (PF03061)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
57  
80
non-globular  
88  
153

PDB Hit:
gi|1633163|pdb|1MKB|A Escherichia coli

Gene Protein Sequence:
MNEKPVLGIQDIQNLLPHRYPFLLVDKILSYDLNTRSVVAQKNVTINEPF
FAGHFPGAPIMPGVLILEALAQAAGVLLGIILENDRDKKIALFLGIQKAK
FRQPVKPGDVLTLKAEFSLISAKGGKAFAQAFVGSQVVAEGELSFVLVKK
ESI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAAAAGCCCGTGTTAGGTATACAGGACATACAAAATTTACTTCC
CCATCGGTATCCCTTTTTATTGGTGGATAAAATTCTTTCTTACGATTTAA
ACACTCGTTCGGTAGTGGCTCAGAAAAATGTAACAATTAACGAACCTTTT
TTTGCGGGACATTTTCCTGGAGCTCCTATCATGCCCGGAGTTTTAATACT
GGAAGCTTTGGCTCAAGCTGCTGGAGTGTTGTTAGGGATTATATTGGAAA
ACGATCGAGATAAAAAGATCGCTTTGTTCTTAGGTATCCAGAAAGCAAAA
TTCCGTCAGCCTGTTAAACCTGGAGACGTATTAACCTTGAAAGCCGAGTT
CTCTTTAATCTCGGCTAAAGGTGGGAAGGCTTTTGCACAAGCCTTTGTAG
GTTCTCAGGTAGTCGCTGAAGGAGAGCTCAGCTTTGTTCTTGTTAAAAAA
GAGTCCATA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy