Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR442 IGR435 IGR438 IGR434 IGR433 IGR440 IGR439 IGR441 IGR437 IGR436 rl23, - CT526 fabZ, - CT532 CT537 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 dnaQ, - CT536 rl2, - CT525 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 rl23, - CT526 fabZ, - CT532 CT537 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 dnaQ, - CT536 rl2, - CT525 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 rl23, - CT526 fabZ, - CT532 vldD,yciA, - CT535 rl3, - CT528 rl4, - CT527 dnaQ, - CT536 rl2, - CT525 lpxC, - CT533 CT529 fmt, - CT530 cutE,lnt, - CT534 lpxA, - CT531 lpxA, - CT531 CT537
* Calculated from Protein Sequence

Gene ID: CT531

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpxA  

Definition:
UDP-N-acetylglucosamine acyltransferase

Gene Start:
599622

Gene Stop:
598783

Gene Length:
840

Molecular Weight*:
30737

pI*:
6.51

Net Charge*:
-2.40

EC:
2.3.1.129  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:
In E.coli, LPXA is involved in the first step of lipid A biosynthesis;
lipid A is an endotoxin that anchors LPS to the outer membrane.
An Xray crystallographic structure is known for this molecule.
CT243 is thought to catalyze the third step in the lipid A
pathway. See also CT533, CT411, CT243.


Blast Summary:  PSI-Blast Search
Numerous hits to LPXA proteins, e.g. residues 3-258 are approximately
41% similar to LPXA_ECOLI. No similarities to T.pallidum or M.genitalium.

CT531 is orthologous to CPn0650: residues 1-280 are 72% similar to CPn0650.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1043
COG name: Acyl-[acyl carrier protein]--UDP-N-acetylglucosamine O-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1043 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Many hits to blocks BL00101A,B, which encompass bacterial hexapeptide repeats:
4-172 are pertinent. Examples of sequences represented by these blocks
are CAT4_ECOLI and LPXA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 88-247 are approximately 40% similar to a acyl-transferase
UDP-N-acetylglucosamine domain represented by LPXA_SALTY.

Paralogs:  Local Blast Search
CT531 is weakly paralogous to CT243, a glucosamine acyltransferase: residues
4-186 are 25% similar to CT243.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
gi|1311000|pdb|1LXA| Udp N-Acetylglucosamine Acyltransferase Transferase, Acyltransferase, Lipid A Biosynthesis, Lipid Synthesis Mol_id: 1; Molecule: Udp N-Acetylglucosamine O-Acyltransferase; Chain: Null; Synonym: Lpxa; Ec: 2.3.1.129; Engineered: Yes; M

Gene Protein Sequence:
MTNIHPTAIVEDGARIGNNVTIEPYAIVKKNVTLCDDVVVKSYAYIDGFT
TIGRGTTVWPSAMIGNKPQDLKFKGEKTFVEIGEHCEIREFAMITSSTFE
GTTVSIGNNCLIMPWAHIAHNCSVGNNVVFSTHVQLAGHVQVGDCVTIGS
MVGVHQFVRIGSYSMVGAMSGIRRDIPPFTIGTGNPYALGGINKVGLQRR
QVSFETRLALIKTFKRVFRSDESFQASLESVLEDFGEVPEVRHFVEFCRQ
PSKRGIERGVDCEASLEEPIDKKEGAFVES

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCAACATTCATCCTACAGCGATTGTGGAAGATGGAGCGCGGATTGG
AAATAATGTGACGATAGAGCCCTATGCTATTGTAAAAAAGAATGTAACGC
TTTGCGATGATGTAGTGGTCAAATCTTACGCATATATCGACGGGTTCACA
ACCATTGGCCGAGGAACAACAGTTTGGCCTTCTGCAATGATCGGAAATAA
GCCGCAAGATCTGAAATTTAAGGGCGAGAAGACTTTTGTTGAAATTGGTG
AGCATTGCGAAATTCGCGAGTTTGCTATGATTACCTCCTCTACATTTGAG
GGGACTACAGTTTCTATAGGGAATAATTGTTTAATTATGCCTTGGGCGCA
TATCGCACACAACTGCTCTGTAGGGAATAATGTTGTATTTAGTACGCATG
TACAGCTTGCCGGGCATGTGCAAGTAGGAGATTGCGTAACTATAGGTAGC
ATGGTGGGTGTGCACCAGTTTGTTCGTATAGGCTCTTACTCAATGGTCGG
AGCTATGAGCGGTATTCGTCGTGATATCCCGCCTTTCACTATAGGGACAG
GCAATCCCTATGCTCTAGGGGGAATCAACAAGGTTGGATTGCAACGGCGG
CAGGTATCTTTTGAAACCCGTCTGGCATTGATTAAGACTTTTAAACGGGT
TTTCCGCTCGGACGAGTCTTTCCAAGCCTCTTTGGAGAGCGTATTAGAAG
ATTTTGGAGAAGTCCCTGAAGTGCGCCATTTCGTTGAATTTTGTCGGCAG
CCAAGCAAACGAGGTATAGAGAGAGGCGTGGATTGCGAAGCATCTTTAGA
AGAGCCGATAGATAAAAAAGAAGGAGCTTTCGTTGAGTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy