Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR428 IGR432 IGR435 IGR430 IGR438 IGR426 IGR434 IGR427 IGR431 IGR433 IGR429 IGR439 IGR437 IGR436 rs17, - CT519 rs19, - CT524 rl24, - CT517 rl22, - CT523 rl23, - CT526 rl14, - CT518 rl16, - CT521 fabZ, - CT532 rl3, - CT528 rl4, - CT527 rs3, - CT522 rl2, - CT525 lpxC, - CT533 CT529 fmt, - CT530 rs17, - CT519 rs19, - CT524 rl24, - CT517 rl22, - CT523 rl23, - CT526 rl14, - CT518 rl16, - CT521 fabZ, - CT532 rl3, - CT528 rl4, - CT527 rs3, - CT522 rl2, - CT525 lpxC, - CT533 CT529 fmt, - CT530 rl22, - CT523 rl23, - CT526 rl14, - CT518 rl16, - CT521 fabZ, - CT532 rl3, - CT528 rl4, - CT527 rs3, - CT522 rl2, - CT525 lpxC, - CT533 CT529 fmt, - CT530 rl29, - CT520 lpxA, - CT531 lpxA, - CT531 rs17, - CT519 rs19, - CT524 rl24, - CT517 rl29, - CT520
* Calculated from Protein Sequence

Gene ID: CT528

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl3  

Definition:
50S ribosomal protein L3

Gene Start:
596343

Gene Stop:
595681

Gene Length:
663

Molecular Weight*:
23500

pI*:
10.43

Net Charge*:
15.15

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
L3 binds 23S RNA.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ribosomal protein L3 sequences, e.g.
residues 5-216 are 41% similar to RL3_BORBU. CT528 is similar to TP0189
in T.pallidum and to MG151 in M.genitalium.

CT528 is orthologously related to CPn0647:
residues 1-216 are 72% similar to that of CPn0647.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0087
COG name: Ribosomal protein L3
Functional Class:  J
The phylogenetic pattern of COG0087 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 4-20, 26-37, 112-137, 121-146, 162-191 are matched to blocks BL00474A,B,C,D, concerned with
L3 sequences, e.g. RL3_BORBU, RL3_BACST, RL3_HAEIN.

ProDom Summary:  Protein Domain Search
Residues 104-191 are 52% similar to a L3 domain observed in RL3_BORBU.
Residues 14-80 are 41% similar to an L3 domain observed in RK3_PORPU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 11 to 214 (E-value = 1.7e-50) place CT528 in the Ribosomal_L3 family which is described as Ribosomal protein L3 (PF00297)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
67  
190

PDB Hit:
none

Gene Protein Sequence:
MRSQLSLIGKKEGMMHVFDKNGNLVACSVISVDANVVAQLKTASSDGYNA
VQMGADVVQAPEKTIEKRFSKALLGHFKKSGGRVCRVLKEVVVSEEAVQS
VSLGDEFGLEIFDGVSNVDICGISKGKGFQGVMKKFGFRGGPKSHGSGFH
RHAGSTGMRSTPGRCFPGSKRPSHMGCDRVTVKNLEVVKVDLDRKVMLVK
GAIPGFKGSVVVVKRSCGVEG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGTCTCAGCTTAGCCTAATAGGGAAAAAGGAAGGCATGATGCATGT
CTTCGATAAGAATGGAAATCTTGTTGCGTGTTCAGTAATTAGCGTAGATG
CAAACGTTGTTGCCCAGCTGAAAACCGCATCTTCAGATGGTTATAATGCT
GTTCAAATGGGAGCTGATGTAGTCCAAGCTCCAGAAAAAACCATTGAAAA
GCGTTTCTCCAAAGCACTACTCGGACATTTTAAGAAGTCCGGAGGACGTG
TTTGTCGTGTTTTAAAAGAAGTTGTCGTTTCAGAAGAGGCTGTTCAGTCT
GTTTCTTTAGGCGATGAATTTGGGTTAGAAATTTTCGACGGAGTATCTAA
CGTTGACATCTGTGGAATTTCTAAGGGTAAAGGCTTCCAAGGGGTGATGA
AAAAATTTGGTTTCCGGGGAGGACCAAAAAGCCACGGTTCTGGATTTCAT
CGTCATGCAGGATCTACTGGGATGCGATCTACTCCTGGCCGATGTTTCCC
CGGAAGTAAACGTCCAAGTCACATGGGATGTGATCGGGTTACGGTCAAGA
ATTTAGAAGTCGTAAAAGTTGACTTGGATAGAAAGGTAATGCTCGTTAAG
GGAGCAATTCCTGGTTTTAAAGGATCCGTTGTTGTTGTGAAGCGTTCTTG
CGGAGTAGAGGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy